KEGG   Synechococcus elongatus PCC6301: syc1895_c
Entry
syc1895_c         CDS       T00163                                 

Gene name
mrcA
Definition
(GenBank) restriction endonuclease
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: HNH_5 HNH HNH_4
Other DBs
NCBI-ProteinID: BAD80085
CyanoBase: syc1895_c
CYORF: syc1895_c
UniProt: A0A0H3KB28
Position
complement(2033860..2034357)
AA seq 165 aa
MGKVLVLNASYEPLNITSWRRAVILLLKDKAESLEHNGRMILPDLPLPTVIRLRQYVRIP
YNEIPLTRRNVLHRDGHSCQYCGYHGENLTLDHILPRSRGGADTWENVITACMRCNVHKG
NRTPKEAGMPLMSTPRQPVSSLYFEISRYLNQGSHQEWRKYVIGA
NT seq 498 nt   +upstreamnt  +downstreamnt
atgggcaaggttttagtgctcaacgcttcctacgagccactcaacatcacgagctggcgg
cgagcagtgatcttgcttttgaaagataaggctgaaagtttagagcacaacggtcgaatg
atcctgcctgatctaccacttccgacggtgattcgactacgtcaatacgtccgtattccc
tacaacgagatcccactaacccgtcgaaatgttttgcatcgagacggtcattcctgtcag
tattgcggctatcacggtgagaatctgaccctcgaccacatcttgccacgatcgcggggg
ggagccgatacctgggagaacgtgattacggcctgcatgcgctgcaacgttcacaagggc
aaccgtacgcctaaagaggcagggatgcccctgatgagcacaccgcgccaacccgtcagc
agcctctactttgagatttcacgctatctcaaccaaggcagccaccaagaatggcgcaag
tacgtgatcggggcttaa

DBGET integrated database retrieval system