KEGG   Synechococcus elongatus PCC6301: syc1896_d
Entry
syc1896_d         CDS       T00163                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00473  D-Alanine metabolism
syc01100  Metabolic pathways
syc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    syc1896_d (alr)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    syc1896_d (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:syc01011]
    syc1896_d (alr)
Enzymes [BR:syc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     syc1896_d (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:syc01011]
 Precursor biosynthesis
  Racemase
   syc1896_d (alr)
SSDB
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Other DBs
NCBI-ProteinID: BAD80086
CyanoBase: syc1896_d
CYORF: syc1896_d
UniProt: A0A0H3K3Y1
Position
2034482..2035702
AA seq 406 aa
MTVKPIDPQPTPRWPARRLEQLSYQRAWVEVDQGAIAANTRQIRQFLAPSCELMAVVKAD
AYGHGAVAIASTVLGAGATALGVATIPEGVRLREAGITAPILLLGSIHSPDEVQAIAHWQ
IQPSLSTPKQALICAEALDRLGQSLPVHLKLDTGMSRLGAPWQTAVEFLQLVHGLPSLQL
ASLYSHFATADSPDRAPLQQQHAAFEQAIAQIQAEGLPVPKLHIANSAATLLDSSLHYDQ
VRVGLALYGLYPAPHLGDRLSLYPALSVKARVTHVTTLPAGQGVSYGHRYVTQRETPIAV
VGIGYADGVPRALSNQMEVLYRGQRLPQIGAITMDQMMIDISAMPQLAPGDVVTLLGRSG
SEQITADDWADRANTISWEILCGFKDRLPRFAVAADWSSNQVTVRS
NT seq 1221 nt   +upstreamnt  +downstreamnt
gtgactgtgaaaccgattgatccccaaccaactccgcgttggccagcgcgacggttagag
caactttcctatcagcgggcttgggtcgaagttgatcagggggcgatcgcggccaacacg
cgtcagatccgccagttcctcgcacccagttgtgaattgatggcagtcgtcaaagcggat
gcctatggtcacggcgctgttgcgatcgccagtacggttttaggtgctggagccactgcc
ttgggagttgccacgatcccggaaggagtacggttgcgggaggcggggatcactgcaccg
attctgctgctgggatcgatccatagccccgacgaagtgcaagcgatcgctcattggcag
atccagcccagtctcagcacccccaagcaggcattaatctgtgcggaagcattagatcgc
ttgggacagtctctccctgtccatctcaaacttgataccggcatgtcccgcctcggagca
ccttggcaaactgcggtcgagttcctgcagctcgttcatggtttgccgtcgctccagctt
gccagtctctactcgcacttcgcaacggcagacagcccagatcgcgcgccgctccagcaa
caacatgcagcatttgaacaggcgatcgcccaaatccaagcagaaggattgccagtccct
aagcttcacattgctaactcagcagcgacgctattggattcgagccttcactacgaccaa
gtccgtgttgggctagcgctgtatgggctttaccccgcaccgcaccttggcgatcgtctg
tctttatatccagctttatcggtcaaagcacgggtgactcacgtcacgaccctgcctgca
ggccaaggcgttagctacggccatcgctacgtgactcaacgggaaacgccgatcgccgtt
gttgggatcggttatgccgatggtgtgccgcgtgccctgtctaatcagatggaggtgctc
taccgcggtcagcggctgccacagattggggcgatcacaatggaccagatgatgatcgac
atctctgccatgccccaattggcaccgggagatgttgtcaccctgttggggcgatcgggg
tcagaacagattaccgctgacgattgggccgatcgcgccaatacgattagctgggaaatt
ctctgcggctttaaagatcggctgccacgctttgccgtcgccgcggattggtcatccaat
caagtcactgtcaggtcttaa

DBGET integrated database retrieval system