KEGG   Synechococcus elongatus PCC6301: syc1897_d
Entry
syc1897_d         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: Cupin_2 AraC_binding Cupin_1 Cupin_3 CENP-C_C EutQ
Other DBs
NCBI-ProteinID: BAD80087
CyanoBase: syc1897_d
CYORF: syc1897_d
UniProt: A0A0H3K493
Position
2035952..2036443
AA seq 163 aa
MSGNCCVLPQIASPASLLVYRLRPQGSNRFAVLFDPEQAGVSLVACFEVFDPGGSTPPNL
HGRAIEFFYVIAGEGEAYCDGKRTAIAAGDMLLIPATGLHEIRNTHQDQRLYVLTLMIPN
EAFIELIRSGIPDRLDAADLAVLQQLRTIPQVPASARVAAAIA
NT seq 492 nt   +upstreamnt  +downstreamnt
atgagtggcaactgctgcgttctacctcaaattgcttcgccggccagcttgctggtctac
cgccttcgtcctcagggaagcaaccgctttgcagtcttattcgatcctgagcaggcagga
gtatccttggtggcttgctttgaggtttttgatccgggtggatctacgcctcccaacttg
catggacgcgcgatcgaatttttctatgtgattgcgggtgaaggcgaagcctactgtgat
ggtaagcgaactgcgattgctgcaggagacatgctgctgattcccgcaaccggattgcat
gaaattcgcaacacccatcaggatcaacgcctctacgtgctgacgctgatgatccccaat
gaggcctttattgagctaatccggtctggcattcccgatcgcctcgatgcggcggattta
gcggtgctgcagcagctacggaccattccacaagttccagcttcagccagagtggctgcg
gcaatcgcctaa

DBGET integrated database retrieval system