KEGG   Synechococcus elongatus PCC6301: syc1898_d
Entry
syc1898_d         CDS       T00163                                 

Gene name
dnaE
Definition
(GenBank) DNA polymerase III alpha subunit
  KO
K02337  DNA polymerase III subunit alpha [EC:2.7.7.7]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc03030  DNA replication
syc03430  Mismatch repair
syc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:syc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    syc1898_d (dnaE)
   03430 Mismatch repair
    syc1898_d (dnaE)
   03440 Homologous recombination
    syc1898_d (dnaE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:syc03032]
    syc1898_d (dnaE)
   03400 DNA repair and recombination proteins [BR:syc03400]
    syc1898_d (dnaE)
Enzymes [BR:syc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     syc1898_d (dnaE)
DNA replication proteins [BR:syc03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     syc1898_d (dnaE)
DNA repair and recombination proteins [BR:syc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     syc1898_d (dnaE)
SSDB
Motif
Pfam: DNA_pol3_alpha DNA_pol3_finger PHP Intein_splicing
Other DBs
NCBI-ProteinID: BAD80088
CyanoBase: syc1898_d
CYORF: syc1898_d
UniProt: A0A0H3K7I1
Position
2036501..2039113
AA seq 870 aa
MSFVGLHMHSDYSLLDGASQLPDLVARAKELGMPAIALTDHGVMYGAIELLKVCKNQGNI
RPIIGNEMYVINSPIDDPNPRVRKYHPIVLAKNKKGYQNLVKLTSISHLQGFKGRGIFAR
PCIDKEHLEKYREGLIVTSACLGGEIPQAILQSRPDVARRVAAWYQERFGEDFYLEIQDH
GSPEDRIVNVEIVRIAQELGIELVATNDSHFISCFDVEAHDALLCIQTGKLVVEDKRLRY
SGTEYLKSAEEMHQLFRDHLPDDVIAKAIANTLVIASKIEDYNILGEPKIPTFPVPDGYN
EETYMAEVARQGLAERLNCDRYEDCEEAYRDRLEYEIKMMHEMGFASYFLVVWDYIKFAR
DNNIPVGPGRGSAAGSLVAYCMGITNIDPVHHGLLFERFLNPERKSMPDIDTDFCIDQRD
KVIDYVTKKYGEDRVAQIITFNRMTSKAVLKDVARVLDIPYGEADRMAKLIPVARGKPAK
LKVMISDQTPAPEFKEKYEKDARVKHWVDMALRIEGTNKTFGVHAAGVVISAVPLDEIVP
LQRNNDGQVITQYYMEDIEACGLLKMDFLGLRNLTMIQKAIDLVQETSGQAIDPDRLPMD
DPKTYQLLAKGDLEGVFQLESSGMRQIVRDLKPSNLEDISSILALYRPGPLDAGLIPKFI
NRKHGREAIDYADQMLQPILNETYGIMVYQEQIMKIAQDMGGYTLGEADLLRRAMGKKKM
SEMVKHQSTFVEGAKKNGVAEKVAAELFDQMVLFAEYCLAADTEVLTVEYGPIAIGKLVE
ENIRCQVYCCNPDGYIYSQPIGQWHQRGEQEVIEYELSDGRIIRATADHRFMTEEGEMLS
LDEIFERSLELKQIPTPLLAIAQPSPLATA
NT seq 2613 nt   +upstreamnt  +downstreamnt
atgtcttttgttggcctgcacatgcacagtgactacagcctgctggatggggcgagtcag
ctaccggatctggtggcgcgagctaaagaactgggaatgcccgcgattgctctgacagat
cacggcgtgatgtatggagcgatcgaactcctcaaagtttgcaaaaatcagggcaatatt
cgaccgattatcggcaatgaaatgtatgtcatcaatagcccgattgatgaccctaaccct
cgcgtccgcaaatatcacccgattgttttagccaagaataagaaaggctatcaaaatctg
gttaagttgacctctatttcgcatctgcaaggctttaaaggacggggaatttttgcacgt
ccttgtattgataaagaacatctcgaaaaataccgtgaaggtctaatcgttacgagtgcc
tgtttggggggtgaaattccccaagcaattttgcaaagtcgtccggatgtggctcgacgg
gtagcagcttggtatcaagagcgctttggcgaagacttctatctggaaattcaagatcac
ggctcacctgaagatcggattgtcaatgtcgaaattgtccgaattgctcaggaactgggg
attgaactggttgccactaacgatagccactttatttcctgttttgatgttgaagcccat
gatgctctgctctgtattcaaacgggcaagcttgtcgtcgaagataaacggcttcgctat
agcggcacagagtacctcaagtctgctgaggaaatgcatcagctatttcgcgatcacttg
ccagatgatgtgattgctaaagcgatcgctaatacgcttgtgattgccagcaagatcgag
gactataacatccttggcgagcctaaaattccgactttccctgtccccgatggctacaac
gaagaaacctatatggcggaagttgctcgtcagggactggcggagcggctcaattgcgat
cgctatgaagactgcgaagaagcttatcgcgatcgcttggaatacgaaattaaaatgatg
cacgaaatgggatttgcctcctatttcttagtggtttgggattacatcaaatttgcccgt
gacaacaatattcctgtgggcccaggtcgtggatcagcggcgggctcactggttgcctac
tgtatgggcatcaccaatattgatccagttcatcatggcttgctattcgaaagattcctg
aatccagaacgcaaatcaatgccggatattgatacagacttctgcattgatcagcgggat
aaagtgattgactatgtgactaaaaagtatggagaagatcgcgttgcccagatcattacc
ttcaaccgaatgacatccaaagcggtgctgaaggatgtggcgcgcgtgctggatatcccc
tacggggaagccgaccgcatggccaagctcatccctgtagcgcggggtaagccggcaaaa
ctgaaggtgatgatttcagatcaaacacctgcgccagagtttaaagaaaaatatgaaaaa
gatgcccgagtgaaacactgggtcgatatggcgctgcgcattgagggaaccaacaaaaca
tttggcgtccatgcagcgggcgtcgtgatttcagccgttccgctcgatgaaattgtgccg
ctccagcggaataatgatggccaagtgatcacgcagtattacatggaggatattgaagcc
tgtggcctcttgaaaatggattttctgggcctcagaaacctgacaatgatccaaaaagcg
atcgatcttgttcaggaaacgagtggacaagccattgatcccgatcgcctaccaatggat
gatccaaaaacctaccagctgttagctaaaggtgatctggaaggggtatttcagttggag
tcttccgggatgcggcaaattgtccgcgatttgaaaccatctaacctcgaagatatttct
tcaattctggcactctatcggccggggcctttggatgctggtttgattcctaaatttatt
aatcggaagcatggccgagaagcgatcgactatgccgatcagatgcttcagcccatcctg
aatgaaacctacggaatcatggtttatcaggaacaaattatgaaaattgctcaagacatg
ggtggctacacactcggagaagctgacttgcttcggcgggcgatgggcaagaagaaaatg
tcggagatggtcaaacaccaaagcacctttgtcgaaggtgcaaagaagaatggtgttgca
gaaaaggttgcagctgagctctttgatcagatggtgctgtttgccgaatattgtttggcg
gcagatacagaagttctgaccgttgaatatggcccgatcgcaattggcaaactagtcgaa
gaaaatattcgttgccaagtttattgctgtaacccagatggctatatctacagtcagccg
attggtcaatggcatcaacgaggtgaacaggaagtgattgaatacgaactcagtgatggt
cgcatcattcgagcaactgctgaccatcgctttatgactgaagagggtgaaatgctgtcg
ctggatgaaatctttgagcgatcgctagaactgaagcagattccgacaccattgttagcg
atcgctcagccatccccgttagcgacggcgtaa

DBGET integrated database retrieval system