KEGG   Synechococcus elongatus PCC6301: syc1899_c
Entry
syc1899_c         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: NurA
Other DBs
NCBI-ProteinID: BAD80089
CyanoBase: syc1899_c
CYORF: syc1899_c
UniProt: A0A0H3K4M1
Position
complement(2039099..2040229)
AA seq 376 aa
MPTRASEIRRLLESKRHQFNRADDQFQSLLQLYRDAFRQLARLPDSWIDGHLLDLPLSLD
GSLWRFPERWPHREASLDWARSQIQGVTTFAVDGSQIYPSKDFSLPIALVQIAWFENPHE
LKQPYTKEIAVDLLAPADFQDLSPENFDRLVNMRRFQMETERLVQFLESHAGQPNCCALL
DGSLVATFAEAFEAETQQVYIDCLVRLLRASENSRVPLIAYIDTSSAKDLAELLQDWFEE
LPEPRSLVDAQIVAQGLRWGDRTPLLRCRRSILKAYAEQSDRLAYCYLKTHDGNPVRIEL
PLWLVESGQHETVLNWLRAEVIAGGGYPYAIETADQAAVLRSDDRQLFYRLLQEWCDQEG
LNLSLSRKLVSKLRRR
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgcccactcgtgccagtgaaattcggcgtttgctcgagagtaaacgacatcagtttaac
cgcgcagatgaccagtttcaaagcttgctacagctctatcgagatgcctttcgacagtta
gcaaggctacctgatagctggattgatggtcatctcttggatctgccgctcagtcttgat
ggcagtctttggcgatttcctgaacgctggccccatcgagaagccagtcttgattgggca
cgatcgcagattcaaggggtcacaacctttgcagtagatggctcgcagatctatcccagc
aaagatttttcactaccgattgccctagttcaaatcgcttggtttgagaatcctcacgaa
ctgaagcagccttacaccaaagagattgcagtcgatctcctggcccctgcagactttcag
gatctgtcgcccgaaaactttgaccgattggtcaatatgcgtcgtttccagatggagaca
gaacgccttgttcagttcctcgagagtcacgcaggtcagcctaactgctgtgctttgtta
gatggttccttagtggcaacctttgctgaagcatttgaggctgaaacccagcaagtttac
attgattgtttagtccgactcctccgagcgagtgagaacagtcgtgttcccctcatcgct
tatatcgacacttcttcagcaaaagacttagctgaattactgcaggattggtttgaggaa
ttgcccgagccacgatcgcttgtcgatgctcaaattgtggcgcagggattacgctggggc
gatcgcacacccctactacgctgtcgcagaagcatcctcaaagcctatgcagaacagagc
gatcgcttagcctattgctatctcaaaacccatgacggcaaccctgttcggattgaattg
cccttgtggttagtggaatcgggtcaacatgagacagtactgaattggttgcgcgctgaa
gtaattgcaggcggcggctatccctatgcgatcgaaactgcggatcaagcggctgttctt
cgcagcgacgatcgccaattgttctatcgcctcttgcaggaatggtgtgatcaagaagga
ctgaatctcagcctttcgcgaaagttagttagcaagttacgccgtcgctaa

DBGET integrated database retrieval system