KEGG   Synechococcus elongatus PCC6301: syc1900_c
Entry
syc1900_c         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00330  Arginine and proline metabolism
syc00332  Carbapenem biosynthesis
syc01100  Metabolic pathways
syc01110  Biosynthesis of secondary metabolites
syc01230  Biosynthesis of amino acids
Module
syc_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    syc1900_c
  09110 Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    syc1900_c
Enzymes [BR:syc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     syc1900_c
SSDB
Motif
Pfam: AA_kinase PUA PUA_3
Other DBs
NCBI-ProteinID: BAD80090
CyanoBase: syc1900_c
CYORF: syc1900_c
UniProt: Q5N0T0
Position
complement(2040243..2041355)
AA seq 370 aa
MAPMSETLVVKIGTSSLTNPHHPGLALSTIAGLVEVICQLRRQGYNVVLVSSGAVGVGCT
RLGLRDRPSRIAQRQAIAAVGQGRLMRTYDDLFTTLGQPIAQVLLTRGDLAQRQRYINAY
QTFQELFELGVVPIVNENDTVAVEELKFGDNDTLSALVASLVEAQWLFLLTDVDRLYTAD
PRQDPNAKPITIVHDLSELESIQAGGQGSRWGTGGMATKLTAAKIATQASVRTVITQGRS
PENLLKILAGEAIGTWFEPQPETVNARKRWIAHGLVPTGKLLLDAGAVQAIQAGGKSLLA
AGIQAIEGDFEAQDAVQLCDLNGTEIARGLVNYDSHELQQIRGCQSDQIVQILGYEGAET
IVHRDNLVLS
NT seq 1113 nt   +upstreamnt  +downstreamnt
gtggctcccatgtccgagaccctcgtggtcaaaattggcaccagcagtctgaccaatccc
caccatccgggcttggcactctcgacgattgcggggctggttgaagtgatttgccaactg
cgccgacagggctacaacgtcgttctagtctcctcgggcgcggttggggtcggttgcact
cgccttgggctgcgcgatcgccccagccgtattgcccaacgtcaggcgatcgcagcggtc
ggtcagggtcgcttgatgcgcacctacgacgatctgtttacgaccctcggtcagccgatc
gctcaagttctgctaacgcgcggtgatctggcgcagcggcaacgctacatcaatgcctat
caaacctttcaggaactattcgagctgggcgtcgtgccaattgtcaacgagaatgacacg
gtcgctgttgaagaactcaagtttggcgacaatgacacgctgtcggccttagtcgccagt
ctcgtggaagcgcaatggctgttcctactaaccgatgttgatcggctctacacagccgac
cctcgccaggatccaaatgctaagccgatcacaattgtccacgacctctcggagctggaa
tcgattcaagcaggtggacagggcagtcgctggggtacaggcggtatggcaacgaagttg
actgcagcgaaaattgctacccaagcgagcgttcgtaccgtgattacccaagggcgatcg
cccgaaaatctgctgaaaatcttggcgggtgaggcgatcggcacttggtttgagccgcaa
ccggaaacagtcaatgcccgcaaacgctggattgcccacggcctcgtgccaactggaaaa
ctgttgctggatgctggtgcagtgcaagcgattcaagcagggggtaagtcgcttttagcc
gctggaattcaagcgatcgaaggagattttgaagcccaagatgcagttcagctctgtgat
ctcaacggcactgaaattgcccgaggattagtcaactatgacagtcacgaactgcagcag
atccgtggctgtcaaagtgatcaaattgttcaaatcctaggctacgaaggtgcagaaacc
atcgtccatcgcgacaacttagttttaagctag

DBGET integrated database retrieval system