KEGG   Synechococcus elongatus PCC6301: syc1901_d
Entry
syc1901_d         CDS       T00163                                 

Definition
(GenBank) unknown protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: FecR Cupin_3 Lipocalin_9
Other DBs
NCBI-ProteinID: BAD80091
CyanoBase: syc1901_d
CYORF: syc1901_d
UniProt: A0A0H3KB34
Position
2041484..2042125
AA seq 213 aa
MWRAIAVASLVLTACAPTQQLQAEIQEVATSPVFASQPNQAEQPASEGTVVIQGGQIRTE
SPGKAQIQLSDGLQFRLGGNALLKIEPELQLDRGQIIAWLTPNQKRDRPLQIRTPTATAA
IRGTTVFIEQTETQALILSWEGQVEVQLPSGVTTQLTSGQLVRLRPGQTTLPTPERLSRP
AAEQRFQRSLLLNGFATPMETLPEIRRQLLGLS
NT seq 642 nt   +upstreamnt  +downstreamnt
atgtggcgggcgatcgcagtggcgagtttggtgctcacagcttgcgcgcccacgcagcag
cttcaggcagaaattcaagaagtcgcgacctcacccgtctttgccagccaacccaatcaa
gcagaacaaccggcctctgaggggacagttgttattcaaggcggacaaattcgtaccgag
agtcccggtaaagcccaaattcaactgagtgatggtctgcagtttcgactgggtggcaac
gccttgttgaaaattgagcctgaactccagctcgatcgcggtcagattattgcttggctg
acgccgaatcaaaagcgcgatcgccccttgcaaatccgcacgccaactgccacagccgct
attcgcggcacaacggtctttattgagcaaacagagacccaagctctgatcttgagctgg
gaaggacaagtggaggtgcagctaccttctggtgtgaccacacagctgacaagtggtcaa
ttggttcgccttcggcccggccaaacgaccttgccgacgccagagcgtttgagtcgtccc
gcagctgagcaacgcttccaacgaagcctgctgctgaatggtttcgccacgccgatggaa
acgctgcccgaaattcgccgccaactattgggactgtcttag

DBGET integrated database retrieval system