KEGG   Synechococcus elongatus PCC6301: syc1902_d
Entry
syc1902_d         CDS       T00163                                 

Gene name
cya2
Definition
(GenBank) guanylyl cyclase
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: CHASE2 Guanylate_cyc Phage_fiber_2
Other DBs
NCBI-ProteinID: BAD80092
CyanoBase: syc1902_d
CYORF: syc1902_d
UniProt: A0A0H3K3Y5
Position
2042129..2043976
AA seq 615 aa
MAIARRLGWSLPTALAGAIALAGLLLSPLAISPLTQPGRWLDAVLLSAAFRLRGPQAPDP
AIAIVVIDEDSLRLGDLFTAAELEARPPLADLQDWPWPRRIYALALQRLRAAGARRVIFD
IVFATPTRFGPDDDRRFADAIAQAGSSVTLAGELEQVDRSAGLSQASLAQPIYEHPFGLA
NLIAGADGSLQAIPGQDWLQPWQILQARDRPPLSNLASAALGQAPPPLSLGINYSGPEGT
YPRWPFWALFDPELWQGPLQQGAVFRDRDVLIGASASSLGDRHATPFADSMAGVEIQANA
IATLRSQRGLRSLPQVWLSLLLILVALLQIWGVQRCPSPLSKALWTLGITSAVLLACFIA
FLQTWLVSPTALLLVPLLAGIGDSANSAWQVQRERRSLRRALALRVSPALLGTILAQRDA
VANQLGGHNCEAVILFSDLRGFTQLSSQIDSTVLVALLNRYFEAMAQPILAAQGLIDKFV
GDAIMAEFGLPLSRGTVIEAQAAIQAALAMRRSLARLRAELVAEGLPPLFHGIGLNFGTV
VAGNLGAPERLEYTVIGDAVNIAARLESLTKTLGYDIIISQALYEQVQEQVEVMPLGLQQ
LRWAIAAGVHLCCLG
NT seq 1848 nt   +upstreamnt  +downstreamnt
atggcgatcgctcggcggttaggctggtcgcttcccacagcactggcgggtgcgatcgcc
ctcgccgggttgttgctctcaccgttggcaatcagtccactgacccaaccggggcgctgg
ctagatgcggtgttattgagtgcggcctttcggttgcgaggcccccaagccccagatccc
gcgatcgcaatcgtggtgatcgatgaggattcgctgcgactgggtgatctgttcacggca
gcggagttagaggcacgtccgcctctggcagatcttcaagactggccctggccgcgccgc
atttacgccttggcgctccagcgtttgcgagctgccggggcgcgacgggtcatcttcgat
attgtttttgccactcctacccgctttggaccggatgatgatcgccgctttgcggatgcg
atcgcccaagccggatcgtccgtgacgctcgctggagaactggagcaggttgatcgtagt
gccggacttagtcaggctagcctcgctcaacccatctatgaacatccctttggcctagcc
aatctgatagcaggcgcagatggcagtctgcaagcgatccccggtcaagactggcttcaa
ccttggcaaatcttacaagcccgcgatcgcccgcctctatctaaccttgcgagtgcagct
ctgggacaggcgccgccgcctctctccttaggcatcaactacagcggccctgagggaacc
tatccacgctggccattttgggcgttgttcgatccagaactctggcagggaccactgcag
caaggtgctgtctttcgcgatcgcgatgttttgattggggccagtgccagcagtctgggc
gatcgccatgccacaccctttgccgacagcatggccggtgtcgagatccaagccaatgcg
atcgccaccctccgcagtcaacgcggtttgcgatcgcttccgcaagtttggttatcgctg
ctattgatccttgtggccctgctccagatctggggtgttcagcgctgtccgagtccgctt
agcaaagcactctggacgttggggatcacgagcgcagtcttactggcttgcttcatcgcc
tttttgcaaacttggctggtgtcgcccaccgccttgctccttgtgccattgctggcaggc
atcggtgacagtgccaacagcgcttggcaagtgcaacgggaacggcgatcgctacgacgc
gccttagcgctgcgggtgtcgccagccttactgggtacgattctggcgcagcgggatgcg
gtagccaatcagctcggtgggcataactgcgaagcagtgatcctgttttcggatctgcgt
gggtttacgcagttgtccagccaaatcgactcgactgtgttggtggcgctgctcaatcgc
tactttgaggcgatggcccagccgattctggcggcgcaggggttgatcgataaatttgtt
ggcgatgcgatcatggcggagtttgggctgccgctcagtcggggcaccgtgatcgaagcc
caggcggcgattcaagcagccctcgccatgcggcgatcgctcgcccgtttgcgagctgaa
ttagtcgctgaaggcttaccacctttgtttcatggcattggactgaatttcgggacagta
gtcgctggcaatctaggcgcgcccgagcggctggaatataccgtgattggcgatgcggtt
aatatcgctgcccgtctggaaagtctgaccaagacactgggctatgacatcatcatttcc
caagcgctctatgagcaggtgcaagagcaggttgaagtgatgcccttgggcctccaacag
ctccgctgggcgatcgcagccggtgttcacctatgctgtcttggatga

DBGET integrated database retrieval system