KEGG   Synechococcus elongatus PCC6301: syc1903_d
Entry
syc1903_d         CDS       T00163                                 

Definition
(GenBank) unknown protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: DUF3307
Other DBs
NCBI-ProteinID: BAD80093
CyanoBase: syc1903_d
CYORF: syc1903_d
UniProt: A0A0H3K498
Position
2044028..2044396
AA seq 122 aa
MATRDKSDVIAQGGTLLFLLIAGHFLGDFGLQSDTMAREKSRHSTTPLQKSVPWYWWLSA
HTLIHGGIVTLLTGSGLLGMIEVGIHAIADWLKCENRTTLLQDQILHLLTKLGFWLWLLQ
TM
NT seq 369 nt   +upstreamnt  +downstreamnt
gtggcaacaagggataaatcggacgtgatcgctcagggtggaacgctgctattcctgttg
attgccggtcattttctcggtgatttcggactgcaatccgatacgatggcgcgcgaaaaa
tcgcgtcattccaccacacccctccaaaaaagtgtcccttggtattggtggctttcagct
cacacattgatccatggtgggattgtcacacttctgacgggctcaggcttgctgggcatg
attgaggtgggaattcatgcgatcgcagattggctgaagtgtgagaaccgcacgacactc
ctgcaggatcaaattctgcacttgctgacgaaattgggtttttggttgtggctgctgcag
accatgtag

DBGET integrated database retrieval system