KEGG   Synechococcus elongatus PCC6301: syc1904_d
Entry
syc1904_d         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: HD_5 GAF GAF_2 GAF_3 HD
Other DBs
NCBI-ProteinID: BAD80094
CyanoBase: syc1904_d
CYORF: syc1904_d
UniProt: A0A0H3K7I9
Position
2044375..2046057
AA seq 560 aa
MAAADHVEPAIAPDRSEAKATATLLERLLAIGTALSACRDPDQLLSLILQSSRDLTCSDG
GSLYLVDRSDPQQPWLRFQIFQSDSLPSSLEAPPPLPLDRHSLAGYVAATGETLNLADVY
ALDGQQPFQFNASFDQRLNYRTCSMLVLPMCDQTGSVIGVIQLVNRKRRADLKLTAAIAS
EETQPYSAAEEALLRSLAGQAAIAIERTLLQRSIENLFEGFICASIKIIESRDPCTMGHS
EWVAQLSVRLAEQVHAVDHGALAAYQFSNAQLQELHYASLLHDFGKVGVPEEILNKSHKL
HPTEQQGLNYRLQLLQQQLQLEQARRWLAPTLTEAMQRAGLGHPLDCIWCRQFGNLADLE
VTIARLQQARSLLQDLNQPQILATPAYRDRLAEVEAELAWLASLQVMDWDGQMRSLLAPA
EVEKLLIPKGSLTQQERLAIESHVQHTFAFLQEIPWTGPLAQVPHIAHAHHERLDGSGYP
LGLEQAQIPMQAQIMAVADVYDALTASDRPYKRRVPIEKALQILEWEARDRKLNDQLVQL
FRQQQIFQILGHQLQSEDSV
NT seq 1683 nt   +upstreamnt  +downstreamnt
gtggctgctgcagaccatgtagaaccagcgatcgcgcctgatcgatctgaggcgaaggcc
acagcaaccctactggagcgactgctcgcgatcggcactgccctttctgcttgccgagat
cccgatcagttactgagcttgattttgcagagtagccgggatctgacctgcagtgacggt
ggcagtttgtacctcgttgatcgcagtgatccgcagcagccttggctgcgcttccaaatt
ttccagagcgacagcttgcccagttcccttgaagccccgccaccgctacccctcgatcgc
catagtttggcgggctatgtggcagcgaccggcgaaaccctgaatctggccgatgtttat
gctttggacgggcaacaaccgtttcagttcaacgccagcttcgaccagcggttgaactac
cgcacctgctcgatgttagtgctgccgatgtgcgatcaaaccggcagtgtgatcggggtg
atccaactggtcaatcgcaaacgccgggcagatctgaagctgacggcggcgatcgcctca
gaagaaacccagccctacagtgcggctgaagaagcactcttacgatcactagccggtcaa
gccgcgatcgcaatcgaacgaaccctgttgcagcgcagtattgaaaatctgtttgagggc
tttatctgcgcctcgatcaagatcatcgaatcccgcgatccctgcacgatgggtcattcc
gagtgggtggcgcaactctctgttcgcttggctgaacaagtgcatgccgtcgatcacggt
gcgttagcggcttatcaattcagcaatgcccaactgcaagagctgcactacgcctcactg
ctccatgactttggcaaagtgggggttcctgaggagattctcaacaagtcgcataagctg
catccaactgagcaacaggggctgaactaccgactgcaactactgcagcagcaactgcaa
ctggagcaagcccgtcgttggctggctccaaccctgacggaggcgatgcaacgggctggg
ctagggcatcctctggactgtatctggtgtcggcagtttggcaatttagctgacctagag
gtcacgatcgcccgactccaacaggcacgatcgctgctgcaggatctcaatcagccacaa
attttggcaacccccgcctatcgcgatcgcttagcggaggtggaagcggaattagcctgg
ctggcgtccctgcaggtcatggactgggatggtcagatgcgatcgctgctcgcgcctgca
gaagtggagaaattactgattccgaaggggagtctcacgcagcaggagcgcttggcgatc
gagtcacacgttcagcacaccttcgcttttttacaggagatcccttggacgggaccctta
gcgcaggtgccgcatattgcccatgcccaccacgagcgcttggacggtagtggctatccc
ctcggattagaacaggcacaaattccaatgcaggcgcaaattatggcggttgctgatgtt
tatgatgcgctgacggctagcgatcgcccctacaaacgccgcgttccgattgaaaaagcg
ctgcaaattctagagtgggaagcccgcgatcgcaaactgaatgatcagttggttcaactc
tttcggcagcagcaaatcttccaaattcttggccatcagcttcagtctgaagacagtgtc
taa

DBGET integrated database retrieval system