KEGG   Synechococcus elongatus PCC6301: syc1907_c
Entry
syc1907_c         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
  KO
K07305  peptide-methionine (R)-S-oxide reductase [EC:1.8.4.12]
Organism
syc  Synechococcus elongatus PCC6301
Brite
KEGG Orthology (KO) [BR:syc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    syc1907_c
Enzymes [BR:syc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.12  peptide-methionine (R)-S-oxide reductase
     syc1907_c
SSDB
Motif
Pfam: SelR Yippee-Mis18
Other DBs
NCBI-ProteinID: BAD80097
CyanoBase: syc1907_c
CYORF: syc1907_c
UniProt: A0A0H3K3Y9
Position
complement(2048673..2049095)
AA seq 140 aa
MTEKIRKSEEEWRAQLTPEQFQVTRKHGTERAFTGAYWDTKDPGLYRCICCDAPLFRSDT
KFDSGTGWPSFWAPVDESAITYKKDFSFLMMRTEILCARCDAHLGHVFPDGPKPTGQRYC
LNSASLKLDTETPASPSSEA
NT seq 423 nt   +upstreamnt  +downstreamnt
atgaccgaaaaaattcggaaaagcgaagaagagtggcgggcccagctcacccctgagcag
tttcaagtcactcggaaacacgggactgagcgagctttcacgggcgcctattgggatacc
aaagatcccggcctctaccggtgtatctgttgtgatgcgcctctgttccggtcggatacc
aagtttgattccggcactggctggccgagcttttgggcgccggttgatgagtccgcgatc
acctacaaaaaagatttcagcttcctgatgatgcgcactgagattctttgcgcccgttgc
gatgcgcacttgggacatgtctttcccgatggcccgaaacctacaggacagcgttattgc
ctcaattcggcttcgctgaagttagacactgaaactccggcgagtcccagttccgaagct
tag

DBGET integrated database retrieval system