KEGG   Synechococcus elongatus PCC6301: syc1934_c
Entry
syc1934_c         CDS       T00163                                 

Gene name
spt
Definition
(GenBank) alanine--glyoxylate aminotransferase
  KO
K00830  alanine-glyoxylate transaminase / serine-glyoxylate transaminase / serine-pyruvate transaminase [EC:2.6.1.44 2.6.1.45 2.6.1.51]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00250  Alanine, aspartate and glutamate metabolism
syc00260  Glycine, serine and threonine metabolism
syc00630  Glyoxylate and dicarboxylate metabolism
syc00680  Methane metabolism
syc01100  Metabolic pathways
syc01110  Biosynthesis of secondary metabolites
syc01120  Microbial metabolism in diverse environments
syc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    syc1934_c (spt)
  09102 Energy metabolism
   00680 Methane metabolism
    syc1934_c (spt)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    syc1934_c (spt)
   00260 Glycine, serine and threonine metabolism
    syc1934_c (spt)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:syc01007]
    syc1934_c (spt)
Enzymes [BR:syc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.44  alanine---glyoxylate transaminase
     syc1934_c (spt)
    2.6.1.45  serine---glyoxylate transaminase
     syc1934_c (spt)
    2.6.1.51  serine---pyruvate transaminase
     syc1934_c (spt)
Amino acid related enzymes [BR:syc01007]
 Aminotransferase (transaminase)
  Class V
   syc1934_c (spt)
SSDB
Motif
Pfam: Aminotran_5
Other DBs
NCBI-ProteinID: BAD80124
CyanoBase: syc1934_c
CYORF: syc1934_c
UniProt: A0A0H3K414
Position
complement(2073163..2074392)
AA seq 409 aa
MQCSSRPVTSFNGSKHFSHLPQGCPMTVTLPSVSEKHRVRLQPLELPERLLLGPGPSNAH
PAVLEAISRPPIGHLDPKFLELMTEVQGLLRYIWQTDNRLTIPVSGTGSAAMEATIANSV
EPGDVVLVGVMGYFGNRLVDMAGRYGADVRTIHKPWGDVFSLAELRQALEEHRPQILALV
HAETSTGAEQPLAGVGDLCREFDCLLLIDTVTSLGAVPTLLDEWGVDLAYSCSQKGLSCP
PGVSPFTMGPRAEEKLARRKGKVANWYLDMSLLNQYWGSDRVYHHTAPVNMNFGIREALR
LIADEGIETVWKRHRDNAEYLWAGLEDLGLTCHVPVENRLPTLTTVRIPEGVDGKAVSRQ
LLDEHGIEMGGGLGELAGKVWRIGLMGYNSRRENVDRLLSILADVLPRS
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgcagtgcagtagtcgacctgtaacaagctttaatggctctaagcatttctctcatctg
ccgcagggttgcccgatgaccgtcactcttccgagcgttagcgaaaaacaccgtgtccgt
ctccagccgctggagctaccggagcgtctgctgctcgggcccggtccgtcgaacgcccat
ccagctgtgctggaggcgatcagtcggccacccatcggtcacctcgatcctaaatttctc
gagttgatgaccgaggtacaggggttgctgcgctacatctggcaaaccgataaccgcctg
accattcccgtcagcggcacgggcagtgctgccatggaagccacgatcgccaacagcgtc
gagcctggggatgtcgtcctggtcggcgtcatgggctacttcggcaaccgccttgttgat
atggcgggtcgctacggcgctgatgtgcgcaccattcacaagccttggggtgatgtcttt
agcttggctgaattgcggcaagctttggaagaacaccggccacaaatccttgctctcgtt
catgccgagacttcgacgggcgctgaacaaccgctagccggcgttggcgatctctgtcgt
gagtttgattgcctcttactgatcgacaccgtcaccagcttgggtgcggttccaaccctg
ctggatgagtggggcgtcgatttggcctatagctgcagccaaaaagggctgagctgcccg
ccgggtgtgtcgccgttcacgatggggccccgcgctgaagagaagctggcgcgccgcaag
ggcaaagttgccaactggtatctggatatgtcgttgctcaaccagtactggggcagcgat
cgggtttaccaccacactgcgccggtgaacatgaacttcggcatccgtgaggcgctgcgc
ctgattgccgacgaaggtatcgaaacagtctggaagcgccaccgcgacaatgccgaatat
ctctgggcaggcttggaggatttgggcctgacctgtcacgtcccagtcgaaaatcgcctg
ccgaccctgacgactgtgcggattcctgagggcgtcgatggcaaagccgtcagccgtcaa
ctgctggatgaacacggcatcgaaatgggcggtggcttgggcgaattggcaggtaaagtc
tggcggatcggcctgatgggctacaacagccgtcgcgaaaatgtcgatcgcttgctgagc
attctggcagacgttctcccccgctcttaa

DBGET integrated database retrieval system