KEGG   Synechococcus elongatus PCC6301: syc1946_d
Entry
syc1946_d         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
  KO
K12251  N-carbamoylputrescine amidase [EC:3.5.1.53]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00330  Arginine and proline metabolism
syc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    syc1946_d
Enzymes [BR:syc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.53  N-carbamoylputrescine amidase
     syc1946_d
SSDB
Motif
Pfam: CN_hydrolase
Other DBs
NCBI-ProteinID: BAD80136
CyanoBase: syc1946_d
CYORF: syc1946_d
UniProt: A0A0H3K7P4
Position
2087174..2088007
AA seq 277 aa
MIDRDRVTAAIREAAAAGAELIVLPEIHGGYYFCQTEDPAQFDRAESIPGPSTDYYSAIA
RELSVVLILSLFERRAAGLYHNTAVVIERDGTIAGRYRKMHIPDDPAYYEKFYFTPGDLG
FEPIQTSVGKLGVLVCWDQWYPEAARLMALAGAELLIYPTAIGWDPQDVPEEQQRQLEAW
QTVQRGHAIANGIPVLSVNRVGFEPSPDPAAAGSQFWGSSFIAGPQGEWLAKAGDREPEL
LIADLDRDRSEQVRRIWPFLRDRRIDAYGDLVRRYRD
NT seq 834 nt   +upstreamnt  +downstreamnt
gtgatcgatcgcgatcgcgtgacagcagcgattcgggaagctgcagcagctggggcagaa
ctgattgtgctgcccgagatccacggcggctactacttttgccagaccgaagatccagct
cagtttgatcgcgccgagtccattccaggaccgagtacggactactacagcgcgatcgcc
cgagaactgtccgttgttctcatcctttcgctgtttgagcggcgggcagccggactctac
cacaacactgctgtcgtgattgaacgggatggaacgatcgcgggtcgttaccgcaaaatg
cacattcctgacgatccggcttactacgagaagttctacttcacgccgggcgacttgggg
tttgaaccgattcagacttcggtgggcaagttaggggttctggtctgctgggatcagtgg
tatcccgaagcagcgcgactgatggcgctggctggtgccgagttgctgatctatccgacc
gcaatcggctgggatccgcaagacgtgcccgaggaacaacagcggcaactcgaagcttgg
caaaccgtgcagcggggtcacgcaatcgccaatggaattcccgtgttgagtgtcaatcgg
gttggctttgaaccctcgcccgatccagctgctgcgggcagtcaattctggggcagcagt
ttcattgccgggccgcagggggaatggttagcaaaggctggcgatcgcgagccggaactg
ctgattgctgatctcgatcgcgatcgcagtgaacaggtgcggcggatctggcccttcctg
cgcgatcgccgcatcgatgcctacggcgatttagtacgtcgctatcgagactaa

DBGET integrated database retrieval system