KEGG   Synechococcus elongatus PCC6301: syc1948_cHelp
Entry
syc1948_c         CDS       T00163                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00260  Glycine, serine and threonine metabolism
syc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
syc01100  Metabolic pathways
syc01110  Biosynthesis of secondary metabolites
syc01130  Biosynthesis of antibiotics
syc01230  Biosynthesis of amino acids
Module
syc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:syc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    syc1948_c (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    syc1948_c (trpB)
Enzymes [BR:syc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     syc1948_c (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP LRRNT DUF1971
Motif
Other DBs
NCBI-ProteinID: BAD80138
CyanoBase: syc1948_c
CYORF: syc1948_c
UniProt: A0A0H3KB82
Position
complement(2088860..2090122)
Genome map
AA seq 420 aa AA seqDB search
MTQTPVNPSTTNAWANAIANLGERPDPLGRFGRFGGQYVPETLMPALAELEQAFARYSRD
PEFQAEFEGLLRDYVGRPNPLYFAERLTEYYRRPDGQGPNIYLKREDLNHTGAHKINNAL
GQALMAKRMGKKRIIAETGAGQHGVATATVCARFGLECVIYMGVHDMERQALNVFRMRLM
GAEVRGVAAGSGTLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMIVREFHSMIGREV
RQQAQTLWGGLPDILLACVGGGSNAMGLFNEFVNEPSVRLIGVEAAGRGVDTPEHAATLT
KGRVGVLHGAMSYLLQDDDGQVIEAHSISAGLDYPGVGPEHSYLMDAGRAEYYSVTDDEA
LEAFQRISRLEGIIPALETAHAFAHLEKLCPTLSGNPNLVINCSGRGDKDVQTVAQRLQF
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtgacacaaacgccggtcaatccatccaccaccaacgcgtgggccaacgcgatcgcaaac
ttgggcgaacggcccgatccactagggcgctttggtcgctttggcggccaatacgtgccc
gaaaccctgatgccagccttggcagagctggaacaagcctttgctcgctatagccgcgac
cccgagtttcaagcggaatttgaaggactgctacgcgactacgtcggtcgccccaacccg
ctctacttcgccgagcgactgacggaatactaccgccgtcccgacggtcaaggccccaac
atctacctgaagcgcgaagacctcaaccacacgggcgcccacaaaattaacaatgccctg
ggtcaggctttgatggccaagcgcatgggcaaaaagcggatcattgcggaaaccggcgca
ggtcagcatggcgtagccacagcgacggtctgcgcccgctttggtctggagtgcgtgatc
tacatgggcgtccatgacatggagcgccaggctcttaacgtcttccggatgcgtttgatg
ggcgcggaagtgcggggtgtggcagcaggctctggaacgctcaaagatgccacttccgaa
gcaattcgcgactgggtgaccaacgtcgaaacgacgcactacatcctcggttcagtagca
ggcccgcacccctacccgatgatcgtgcgggagttccacagcatgattggccgcgaagtg
cgccagcaagcccagacactctggggcggcctgccagatattctgctggcctgtgttggc
ggtggctcgaatgccatgggtctgttcaacgagttcgttaatgagccttcggtgcgatta
attggcgtggaagctgccggtcgcggcgttgatacgccggaacatgccgccacgctgact
aaaggccgcgtcggcgtcctacatggagcgatgagctacctgctccaagatgacgatggg
caggtgatcgaagcccactcaatcagcgctggtctggactaccccggtgtgggccctgag
cacagctacctgatggatgcggggcgtgccgagtactacagcgtcaccgatgacgaagca
ctcgaagcgttccaacgaatttcgcgactggagggcatcattccggcgctggaaacagcc
cacgcttttgctcaccttgagaagctctgtccaaccttgagcggcaatcccaacttggtg
atcaactgctcgggacgtggcgataaagacgtacagacggtggcgcaaagactccagttt
taa

DBGET integrated database retrieval system