KEGG   Synechococcus elongatus PCC6301: syc2044_d
Entry
syc2044_d         CDS       T00163                                 

Gene name
psaA
Definition
(GenBank) photosystem I P700 chlorophyll a apoprotein subunit Ia
  KO
K02689  photosystem I P700 chlorophyll a apoprotein A1
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
syc01100  Metabolic pathways
Module
syc_M00163  Photosystem I
syc_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc2044_d (psaA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc2044_d (psaA)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Photosystem I (P700 chlorophyll a) [OT]
   Main subunits
    syc2044_d (psaA)
SSDB
Motif
Pfam: PsaA_PsaB
Other DBs
NCBI-ProteinID: BAD80234
CyanoBase: syc2044_d
CYORF: syc2044_d
UniProt: Q5N0D6
Position
2190994..2193285
AA seq 763 aa
MTISPPEREAKVKATVDKNPVPTSFEKWGKPGHFDRTLAKGPKTTTWIWNLHANAHDFDS
HTSDLEDISRKIFSAHFGHLAVIFIWLSGAYFHGARFSNFSGWLADPTHVKPSAQVVWPI
FGQEILNGDVGGGFHGIQITSGLFQLWRASGYTNEFQLYVTAIGALVMAGLMLFAGWFHY
HKAAPKLEWFQNVESMLNHHLAGLLGLGSLSWAGHQIHVSLPVNKLLDAIDAGEPLVLNG
KTIASAADIPLPHEFLDVSLISQLFPGFEAGVKAFFTLNWSAYADFLTFKGGLNPVTGGL
WLTDTAHHHLAIAVLFIVAGHMYRTNWGIGHSLKEILEAHKGPFTGQGHKGLYEILTTSW
HAQLSINLAILGSISIIVAHHMYAMPPYPYLATDYPTMLSLFTHHIWIGGFLIVGAGAHA
AIFMVRDYDPAKNVDNLLDRVLRHRDAIISHLNWVCIWLGFHSFGLYIHNDTMRALGRPQ
DMFSDSAIQLQPIFAQWIQNIHALAPGNTAPNALASVSQVFGGDVVAVGGKVAAAPIVLG
TADFMVHHIHAFTIHVTALILLKGVLYARSSRLVPDKANLGFRFPCDGPGRGGTCQVSGW
DHVFLGLFWMYNSLSIVIFHYSWKMQSDVWGSVLPDGSVAHIANGNFAQSALTINGWLRD
FLWAQASQVITSYGSSTSAYGLLFLGAHFVWAFSLMFLFSGRGYWQELIESIVWAHNKLK
VAPAIQPRALSIIQGRAVGVAHYLLGGIVTTWSFFLARIIAVG
NT seq 2292 nt   +upstreamnt  +downstreamnt
atgacgataagcccaccggagcgagaagcgaaggtgaaggcgacggttgataaaaatccg
gttccgacttcttttgagaagtggggtaagccgggtcacttcgaccggacgctggccaaa
ggacccaaaaccacaacttggatttggaaccttcacgctaacgctcacgatttcgatagt
cataccagtgaccttgaagatatttcacggaaaatcttcagcgctcactttggtcacctt
gcggtgatctttatctggttgagcggcgcttacttccatggcgctcgcttctccaatttc
agcggctggctggccgatccaacccacgtcaagcccagtgcccaagtcgtttggccgatc
ttcggacaggagatcctcaacggcgatgttggcggtggcttccatggcattcagatcacc
tccggtctgttccagctctggcgggcctccggctacaccaacgagtttcagctctacgtc
acggcgatcggtgcgctcgtgatggcgggtctcatgctgtttgctggctggttccactac
cacaaagcagctcccaagctggaatggttccaaaacgtcgaatcgatgttgaaccaccac
ttggctggcttactcggtctgggcagcttgtcctgggcgggtcaccagattcacgtgtcg
ctgccggtcaacaaactgctggatgcgatcgacgctggcgaaccgttggttctcaacggc
aaaaccatcgcttctgcggctgatattccgctgccgcatgagttcttggatgtcagcctg
atctcgcagctgttcccgggctttgaagccggtgtgaaagccttcttcacgctcaactgg
tcagcctatgccgacttcctgaccttcaaaggtggcctgaaccccgtcaccggtggcctc
tggctgaccgatacggctcaccaccacttggcgatcgccgtcctcttcattgttgcgggt
cacatgtaccgcacgaactggggtatcggccacagcctcaaagaaatcttggaagctcac
aaaggtcctttcactggccaaggccacaaaggtctctatgagattctgaccacttcttgg
catgcccaactgtcgatcaacctagccatcctgggttcgatcagcatcatcgtggctcac
cacatgtacgcgatgcctccgtatccgtacttggcgaccgactacccgacgatgctgtca
ctgtttactcaccacatctggattggtgggttcctgatcgtcggtgctggtgctcacgct
gccattttcatggtgcgggactacgatccggccaagaatgtcgacaacctcctcgatcgc
gttctgcgtcaccgcgatgcgatcatcagccacctgaactgggtgtgcatctggctaggc
ttccacagcttcggcctctacatccacaacgacacgatgcgtgcgttgggccgtccccaa
gacatgttctcggattcggcgattcaactgcagcccatctttgcgcagtggatccaaaac
attcatgcccttgcaccgggtaacactgctcctaacgccctggcttcggtcagccaagtg
tttggtggcgatgtggttgcagtcggcggcaaagtcgctgctgccccgattgtgctgggt
actgcggacttcatggtccaccacatccacgccttcacgattcacgtcacggcgctgatt
ctcctcaagggcgttctctacgctcggagttcgcgtctggttcctgacaaagccaacctt
ggcttccggttcccctgcgacggccctggccgtggcggcacctgccaagtctctggttgg
gaccacgtgttcctaggcttgttctggatgtacaactccctgtcgattgtaattttccac
tacagctggaaaatgcagtccgatgtttggggttccgtgctgcctgatggttcggtagcg
cacatcgcgaatggcaactttgctcaaagtgccctcacgatcaatggctggttgcgtgac
ttcctgtgggcgcaagcgtctcaggtgatcacctcctacggcagctcgacctctgcctat
ggcctgctgttcttgggtgctcactttgtctgggccttcagcttgatgttcctgttcagt
ggccgtggctactggcaagagctgatcgagtccatcgtctgggctcacaacaagctcaaa
gtggctcctgccatccaaccgcgtgcgctcagcatcatccaaggccgggcagtgggcgtt
gctcactacctactgggtggaattgtgaccacatggtctttcttcctggcccgcatcatt
gcagttggttag

DBGET integrated database retrieval system