KEGG   Synechococcus elongatus PCC6301: syc2065_d
Entry
syc2065_d         CDS       T00163                                 

Gene name
cpcG
Definition
(GenBank) phycobilisome rod-core linker polypeptide
  KO
K02290  phycobilisome rod-core linker protein
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00196  Photosynthesis - antenna proteins
syc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00196 Photosynthesis - antenna proteins
    syc2065_d (cpcG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc2065_d (cpcG)
Photosynthesis proteins [BR:syc00194]
 Antenna proteins
  Phycobilisome - Cyanobacteria, Red alga [OT]
   Phycocyanin (PC)
    syc2065_d (cpcG)
SSDB
Motif
Pfam: PBS_linker_poly Dna2
Other DBs
NCBI-ProteinID: BAD80255
CyanoBase: syc2065_d
CYORF: syc2065_d
UniProt: A0A0H3K4R3
Position
2216730..2217482
AA seq 250 aa
MALPLLNYAPTTQNSRVAGFEVPGDEQPKQYNTEDQYSPVQFDEVIQAAYRQIFFHAFKC
DRQTVLESQLRNGQITVRDFIRGLLLSATFRSSFYDKNSNYRFVEQVVQRVLGRDVYGER
EKIAWSLAVATQGYEGFIDTLLNSDEYLSNFGYDKVPYQRRRVLPGRALGETPFNIKSPR
YDSYYRTILGFPKAVFAGGPGKRFPAQYLSAKAGDPGAYLALARSIGARGQALSASADID
YLSKVPYRKR
NT seq 753 nt   +upstreamnt  +downstreamnt
gtggcccttcccctcttgaactacgcgccaacaacgcaaaattcgcgcgtagctggcttc
gaagttcctggcgacgagcagccaaaacagtacaacaccgaagaccagtactcaccggtc
caatttgatgaagtgattcaggcggcctatcgccaaatcttcttccacgccttcaagtgc
gatcgccaaactgttctggaatcgcagctgcggaatggtcaaatcaccgttcgcgatttc
atccgtgggctgttgctctctgcaaccttccgttccagtttctacgacaagaacagtaac
tatcgttttgtcgagcaagtggtccaacgggtgttgggtcgcgatgtttacggcgaacgg
gaaaaaattgcttggtctttggccgttgcaacccaaggctatgaagggttcatcgacact
ctgctcaacagcgatgaatacctgagcaatttcggctacgacaaggtgccttaccaacgt
cgtcgcgtcctgccgggtcgcgccctgggcgaaaccccgttcaacatcaaatcgccccgc
tacgacagctactaccgcacgattctcggcttcccgaaagccgtcttcgccggtggtcct
ggcaagcgcttccctgcgcaatacctcagtgccaaagcgggtgatccaggtgcctacttg
gccttggctcgcagcatcggtgctcgtggtcaagccctgagtgcttcggcggatatcgat
tacctcagcaaagtcccttaccgcaagcgctaa

DBGET integrated database retrieval system