KEGG   Synechococcus elongatus PCC6301: syc2079_d
Entry
syc2079_d         CDS       T00163                                 

Gene name
psbX
Definition
(GenBank) photosystem II PsbX protein
  KO
K02722  photosystem II PsbX protein
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc2079_d (psbX)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc2079_d (psbX)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other subunits in cyanobacteria
    syc2079_d (psbX)
SSDB
Motif
Pfam: PsbX
Other DBs
NCBI-ProteinID: BAD80269
CyanoBase: syc2079_d
CYORF: syc2079_d
UniProt: Q5N0A1
Position
2232108..2232227
AA seq 39 aa
MTPTLSAFIWSLVLGGVIVVIPLTVALIFISQTDKVRRS
NT seq 120 nt   +upstreamnt  +downstreamnt
atgacgccgacgttgtctgctttcatctggagccttgttctgggaggtgtcattgtggtg
attcctctgacggttgcgctcatcttcatcagccaaacggataaagtccgtcgcagctag

DBGET integrated database retrieval system