KEGG   Synechococcus elongatus PCC6301: syc2085_d
Entry
syc2085_d         CDS       T00163                                 

Gene name
psbV
Definition
(GenBank) cytochrome c550
  KO
K02720  photosystem II cytochrome c550
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc2085_d (psbV)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc2085_d (psbV)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other subunits in cyanobacteria
    syc2085_d (psbV)
SSDB
Motif
Pfam: Cytochrom_C550 Cytochrom_C Cytochrome_CBB3
Other DBs
NCBI-ProteinID: BAD80275
CyanoBase: syc2085_d
CYORF: syc2085_d
UniProt: Q5N095
Position
2236890..2237537
AA seq 215 aa
MVNIEDGFGCLWLLQIILPCSQTASTSSSHWAGESCPLRELVRSSSPSMVFKTLRRTLWL
TLAALLAVFQFNLGAAQAAELTAETRTVKLNPQGDNVTLSLKQVAEGKQLFAYACGQCHV
GGITKTDPNVGLDPEALALATPPRDSVESLVDYLHNPTTYDGEREISELHPSTKSTDIFP
KMRNLTEDDLVAISGHILLQPKIVGTKWGGGKIYY
NT seq 648 nt   +upstreamnt  +downstreamnt
atggtaaatattgaggatggttttggttgcctttggctgctgcaaatcattttgccctgt
agccaaaccgcctcaacctcttcatcacattgggctggcgagagctgtcctcttcgagag
ctagtcaggagcagttcaccatccatggttttcaagacgctgagaagaaccctctggctg
actttggcggccctgcttgccgtgtttcagttcaatcttggtgccgctcaggccgctgaa
ctgacagcagaaactcgcacagtcaagctgaatccccaaggcgacaatgtcacgttgagc
ctgaagcaggtggctgaaggcaaacaactgttcgcctatgcctgcggtcaatgccatgtg
ggtggcattaccaagactgacccgaacgtgggtcttgatcctgaggctttggcgctggcc
accccgcctcgcgatagcgtcgaaagcttggtggactatctgcataaccccaccacctac
gatggtgagcgcgagatttcggaattgcaccccagcaccaagagcaccgatatcttcccg
aaaatgcgtaacctgacggaagacgatctggtggcaatctcgggtcacattctgctgcaa
cccaagatcgtcggtactaagtggggcggcggcaagatttactactaa

DBGET integrated database retrieval system