KEGG   Synechococcus elongatus PCC6301: syc2105_d
Entry
syc2105_d         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
  KO
K03282  large conductance mechanosensitive channel
Organism
syc  Synechococcus elongatus PCC6301
Brite
KEGG Orthology (KO) [BR:syc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syc02000]
    syc2105_d
Transporters [BR:syc02000]
 Other transporters
  Pores ion channels [TC:1]
   syc2105_d
SSDB
Motif
Pfam: MscL
Other DBs
NCBI-ProteinID: BAD80295
CyanoBase: syc2105_d
CYORF: syc2105_d
UniProt: Q5N075
Position
2254709..2255110
AA seq 133 aa
MTSRRGRAVGFIRDFQAFILKGNVVELAVAVIIGGAFNKIVSSFVGDLVMPLVNPLIPGG
DWRTAVIGPGLKIGSFAGSVIDFLIIAFVLYLAIRAIERFKRKEEAVVAAAEPDVQQQML
ATLERIADNLEAR
NT seq 402 nt   +upstreamnt  +downstreamnt
atgacttctcgtcgtgggcgagctgttggctttattcgtgattttcaagcgtttattctc
aagggcaatgttgtcgaattggcagtcgccgtgattattggcggtgctttcaataagatt
gtgagctcttttgtgggcgatttagtgatgccacttgtcaatcccctgattccaggagga
gactggcgaacagcagtcattggccccggactcaaaatcggcagctttgctgggtcggtc
attgattttctgatcattgcctttgttctctaccttgccatccgagcgatcgagcgcttc
aagcgcaaggaagaagctgttgtagcagccgcagaaccggatgttcaacagcaaatgttg
gcaacacttgagcgaattgcagacaacctcgaagctcgttaa

DBGET integrated database retrieval system