KEGG   Synechococcus elongatus PCC6301: syc2133_c
Entry
syc2133_c         CDS       T00163                                 

Gene name
psbY
Definition
(GenBank) photosystem II PsbY protein
  KO
K02723  photosystem II PsbY protein
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc2133_c (psbY)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc2133_c (psbY)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other common subunits
    syc2133_c (psbY)
SSDB
Motif
Pfam: PsbY Tad
Other DBs
NCBI-ProteinID: BAD80323
CyanoBase: syc2133_c
CYORF: syc2133_c
UniProt: Q5N047
Position
complement(2283466..2283588)
AA seq 40 aa
MDWRLIVVLAPILLAGGWAVFNIGKAALEQINRALKGDQA
NT seq 123 nt   +upstreamnt  +downstreamnt
atggactggcgtttaattgttgtcctggctccaattttgttggcagggggctgggcggtg
ttcaacatcggcaaagcagcgttggagcagatcaaccgagcgttgaaaggcgaccaagca
taa

DBGET integrated database retrieval system