KEGG   Synechococcus elongatus PCC6301: syc2213_d
Entry
syc2213_d         CDS       T00163                                 

Gene name
psbU
Definition
(GenBank) photosystem II PsbU protein
  KO
K02719  photosystem II PsbU protein
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc2213_d (psbU)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc2213_d (psbU)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other subunits in cyanobacteria
    syc2213_d (psbU)
SSDB
Motif
Pfam: PsbU HHH_3 Lectin_N DUF3693
Other DBs
NCBI-ProteinID: BAD80403
CyanoBase: syc2213_d
CYORF: syc2213_d
UniProt: Q5MZW7
Position
2361825..2362235
AA seq 136 aa
MKQLAQRLFSLALVLALVLGISVQSAQALSLQSPLLAVAEAEIRNEADAQRIEAGGKLDL
NNIGVRAFQQFPGMYPYLASKIVLGGPYDSVDDVLKLDLSDRQREVFEQYKENFTVTPPR
DALNEGDDRINNGIYR
NT seq 411 nt   +upstreamnt  +downstreamnt
atgaaacaacttgcacagcgactgttctccttggcgcttgtgctggcgcttgtgctgggt
atttccgtgcagtctgcacaagcactgtctcttcaatcgcccctgctagcggtcgccgaa
gcagagattcgtaacgaagctgatgctcagcggatcgaagctggcggcaaactcgacctc
aacaacattggggttcgggcattccaacagtttccgggaatgtacccctacctcgccagc
aaaattgttctgggtggcccttacgactccgtggatgatgtgctgaagctcgatctcagc
gatcgccaacgggaagtcttcgagcagtacaaagagaacttcaccgttactcctccccgc
gacgccctcaacgaaggggatgaccggatcaacaacggcatctatcgctaa

DBGET integrated database retrieval system