KEGG   Synechococcus elongatus PCC6301: syc2349_cHelp
Entry
syc2349_c         CDS       T00163                                 

Gene name
gap2
Definition
(GenBank) glyceraldehyde 3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00010  Glycolysis / Gluconeogenesis
syc00710  Carbon fixation in photosynthetic organisms
syc01100  Metabolic pathways
syc01110  Biosynthesis of secondary metabolites
syc01120  Microbial metabolism in diverse environments
syc01130  Biosynthesis of antibiotics
syc01200  Carbon metabolism
syc01230  Biosynthesis of amino acids
Module
syc_M00002  Glycolysis, core module involving three-carbon compounds
syc_M00165  Reductive pentose phosphate cycle (Calvin cycle)
syc_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
syc_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    syc2349_c (gap2)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    syc2349_c (gap2)
Enzymes [BR:syc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     syc2349_c (gap2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: BAD80539
CyanoBase: syc2349_c
CYORF: syc2349_c
UniProt: A0A0H3K545
Structure
PDB: 

Position
complement(2503217..2504236)
Genome map
AA seq 339 aa AA seqDB search
MTIRVAINGFGRIGRNFLRCWFGRQNTDLEVVAINNTSDARTAAHLLEYDSVLGRFNADI
SYDENSITVNGKTMKIVCDRNPLNLPWKEWDIDLVIESTGVFVTAEGASKHIQAGAKKVP
ITAPGKGEGVGTYVIGVNDSEYRHEDFAVISNASCTTNCLAPVAKVLHDNFGIIKGTMTT
THSYTLDQRILDASHRDLRRARAAAVNIVPTTTGAAKAVALVIPELKGKLNGIALRVPTP
NVSVVDLVVQVEKPTITEQVNEVLQKASQTTMKGIIKYSDLPLVSSDFRGTDESSIVDSS
LTLVMDGDLVKVIAWYDNEWGYSQRVVDLAELAARKWAA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgacgattcgagttgcgatcaatggctttggccgtattggccggaattttctccgttgc
tggtttggacggcagaacaccgatctagaggttgtggccattaacaacacctcggatgca
cggacggctgctcacctgctggagtacgactctgttctcggccggttcaacgccgacatc
agctacgacgaaaattcgatcaccgtcaacggcaagacgatgaaaatcgtctgcgatcgc
aaccccctcaacctgccttggaaagagtgggatatcgatctcgtcattgaatctacaggt
gtgttcgtcaccgctgaaggcgcatccaagcacatccaagccggggccaagaaagttccg
atcacggctcctggtaaaggcgaaggtgtcggcacctacgtcatcggtgtcaacgattcg
gaataccgccacgaagacttcgcagtcatcagcaatgcaagctgcaccaccaactgctta
gcaccggtcgccaaagttctgcatgacaactttggcatcatcaaaggcacgatgaccacc
acccacagctacacgctggaccagcgcatcttggacgccagccaccgtgatctacgtcgg
gctcgggctgcagccgttaacatcgttcccaccacgaccggcgctgctaaagccgttgct
ttggtgatccccgagctgaaaggcaaactaaacgggattgcgctgcgcgttcctacgcca
aacgtgtctgtcgttgacttggtggttcaagtcgagaaaccgacgatcactgagcaggtc
aatgaagtcctgcaaaaagcttctcaaacgacgatgaagggcatcatcaagtactcggat
ctgcccttggtctcttccgacttccggggtactgacgagtcttcgatcgttgactccagc
ctgaccttggtaatggatggcgatctcgtcaaagtaattgcttggtacgacaacgagtgg
ggctacagccaacgagttgtcgacttggctgaactggccgctcgcaaatgggccgcttag

DBGET integrated database retrieval system