KEGG   Synechococcus elongatus PCC6301: syc2386_c
Entry
syc2386_c         CDS       T00163                                 

Gene name
psbI
Definition
(GenBank) photosystem II PsbI protein
  KO
K02710  photosystem II PsbI protein
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc2386_c (psbI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc2386_c (psbI)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other common subunits
    syc2386_c (psbI)
SSDB
Motif
Pfam: PsbI
Other DBs
NCBI-ProteinID: BAD80576
CyanoBase: syc2386_c
CYORF: syc2386_c
UniProt: P17747
Position
complement(2543985..2544104)
AA seq 39 aa
MLALKVTVYVVVLFFVALFVFGFLSSDPARTPSRKDLED
NT seq 120 nt   +upstreamnt  +downstreamnt
atgctggctttgaaggttacggtctacgtcgtcgtactcttcttcgttgctctcttcgtc
ttcggcttcctgtcgagtgacccggcccggaccccgagccgtaaagacctcgaagattag

DBGET integrated database retrieval system