KEGG   Synechococcus elongatus PCC6301: syc2411_c
Entry
syc2411_c         CDS       T00163                                 

Gene name
psbW
Definition
(GenBank) photosystem II reaction center 13 kDa protein
  KO
K08903  photosystem II 13kDa protein
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc2411_c (psbW)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc2411_c (psbW)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other common subunits
    syc2411_c (psbW)
SSDB
Motif
Pfam: Psb28
Other DBs
NCBI-ProteinID: BAD80601
CyanoBase: syc2411_c
CYORF: syc2411_c
UniProt: Q5MZB9
Position
complement(2569460..2569798)
AA seq 112 aa
MSAAIQFTRGIDEPVVPDVRLTRSRDGQNGTATFYFDEPQALVGEVRQDITGMYLLDDEG
ELATREVKAKFINGQPAGLEAVYLMRSPEEWDRFMRFMQRYAEANGLGFTEA
NT seq 339 nt   +upstreamnt  +downstreamnt
atgtccgctgcgatccagttcacgcgtggaattgacgaacccgtcgttcctgatgtccgt
ttgacacgatcgcgcgatggccaaaacggcaccgcaaccttctacttcgatgagccccaa
gctttggtgggcgaggttcgccaagacatcactggcatgtatctgctcgacgatgaaggt
gagctagccacacgggaagtcaaggccaaattcattaacggtcaaccagcgggtctagaa
gcggtttacctgatgcgcagccccgaagaatgggatcgctttatgcggtttatgcagcgc
tatgccgaagcgaacggtttaggtttcacagaagcttag

DBGET integrated database retrieval system