KEGG   Synechococcus elongatus PCC6301: syc2484_c
Entry
syc2484_c         CDS       T00163                                 

Gene name
petF
Definition
(GenBank) ferredoxin petF-like protein
  KO
K02639  ferredoxin
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc2484_c (petF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc2484_c (petF)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Photosynthetic electron transport
   syc2484_c (petF)
SSDB
Motif
Pfam: Fer2
Other DBs
NCBI-ProteinID: BAD80674
CyanoBase: syc2484_c
CYORF: syc2484_c
UniProt: P0A3D3
Position
complement(2645856..2646155)
AA seq 99 aa
MATYKVTLVNAAEGLNTTIDVADDTYILDAAEEQGIDLPYSCRAGACSTCAGKVVSGTVD
QSDQSFLDDDQIAAGFVLTCVAYPTSDVTIETHKEEDLY
NT seq 300 nt   +upstreamnt  +downstreamnt
atggcaacctacaaggttacgctcgtcaatgctgccgaaggcttgaacaccacgatcgac
gtggctgacgatacctacatcttggacgccgctgaagagcaaggcattgacctgccttac
tcctgccgtgctggtgcttgctcgacctgtgctggcaaagtcgtctctggtaccgtcgac
caatcggatcaatccttcttggatgacgaccaaattgcagcaggctttgtcctgacctgc
gtcgcctatccgacctccgatgtgacgatcgaaacccacaaagaagaagacctctactaa

DBGET integrated database retrieval system