KEGG   Synechococcus sp. CC9605: Syncc9605_0091Help
Entry
Syncc9605_0091    CDS       T00292                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
syd  Synechococcus sp. CC9605
Pathway
syd00480  Glutathione metabolism
syd00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:syd00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Syncc9605_0091
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Syncc9605_0091
Enzymes [BR:syd01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Syncc9605_0091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin DUF4174
Motif
Other DBs
NCBI-ProteinID: ABB33870
CyanoBase: Syncc9605_0091
CYORF: Syncc9605_0091
UniProt: Q3ANG2
Position
complement(91712..92236)
Genome map
AA seq 174 aa AA seqDB search
MYGRYSRLTSALHPCFTMAISVSAVSVTTPDGSSKSLGDYAGKVLLIVNVASRCGFTKQY
AGLQALNEAYAAKGLAVLGFPCNDFGAQEPGSLDEIKSFCSTTYGADFELFEKVHAKGST
TEPYTTLNQMEPSGDVEWNFEKFLVGKNGTVIARFKSGVTPEDLKSAIEAALAA
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
gtgtatggccgttacagccggttaacctctgcgctccatccttgtttcaccatggcgatc
agcgtcagtgccgtctccgtcaccacccctgacggcagcagcaaatccctgggcgattac
gccggcaaggtgctgctgatcgtgaacgtggccagccgctgtggcttcaccaagcagtac
gcgggtctgcaggccctcaatgaggcctatgccgccaagggcctggcggtgctgggcttc
ccctgcaacgacttcggcgcccaggagcccggcagcctggacgaaatcaagagcttctgc
tccaccacctacggcgctgacttcgaactgttcgagaaggtgcacgccaaaggcagcacc
acggagccctacaccaccctcaatcagatggaaccctccggtgatgtggagtggaacttc
gagaagttcctggtgggcaaaaacggcaccgtgatcgctcgcttcaagagcggcgtcacc
cctgaagacctcaagtcggcgattgaggcggctctggcggcttga

DBGET integrated database retrieval system