KEGG   Synechococcus sp. CC9605: Syncc9605_0632Help
Entry
Syncc9605_0632    CDS       T00292                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
syd  Synechococcus sp. CC9605
Pathway
syd00230  Purine metabolism
syd01100  Metabolic pathways
Module
syd_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:syd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Syncc9605_0632
Enzymes [BR:syd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Syncc9605_0632
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 RsgA_GTPase AAA_33 AAA_22 MMR_HSR1 AAA_18 AAA_29 ABC_tran NTPase_1 ATPase_2 AAA_17 cobW AAA_14 AAA_28 AAA_23 AAA_30 AAA_5 Rad17
Motif
Other DBs
NCBI-ProteinID: ABB34406
CyanoBase: Syncc9605_0632
CYORF: Syncc9605_0632
UniProt: Q3ALX6
Position
611035..611592
Genome map
AA seq 185 aa AA seqDB search
MSTSGKLTLITGPSGVGKGTLVNQLLERHPQIWLSVSATTRSPRQGEQDGINYFFHSRAG
FEALVEQGGFLEWAEFAGNCYGTPRGPVEQQMAAGRPVLLEIELEGARQVRRSFPDGFQI
FLAPPSFDELERRIRGRGTDSEDAIQRRLTRAREELEAQQEFDAVVINDDLESALNQVET
LMGLG
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccagtggaaagctcaccttgatcaccggccccagtggcgtcggcaagggaacc
ctggtgaaccagctgctggaacggcatccccagatctggctgtcggtgtcggccaccacc
cgttcgccgcgccagggggagcaggacggcatcaactacttcttccacagccgtgcgggg
tttgaggccttggtggagcagggaggttttcttgagtgggcggaatttgcggggaattgc
tacggcaccccccgaggtcccgttgagcaacagatggcggcggggcgccccgtgctgctg
gagattgagcttgaaggtgcccgtcaggtgcgtcgcagttttccggacggttttcagatt
tttctggctccccccagctttgatgagttggagcgccggattcgggggcgcggaaccgat
tcagaggacgccattcagcgccgcctgactcgcgctcgcgaagaactcgaggcccaacag
gaattcgacgctgtcgtgatcaatgacgatctcgaatcagcgttgaaccaggtggagacc
ctgatggggctgggatga

DBGET integrated database retrieval system