KEGG   Synechococcus sp. CC9605: Syncc9605_0990Help
Entry
Syncc9605_0990    CDS       T00292                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
syd  Synechococcus sp. CC9605
Pathway
syd00260  Glycine, serine and threonine metabolism
syd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
syd01100  Metabolic pathways
syd01110  Biosynthesis of secondary metabolites
syd01130  Biosynthesis of antibiotics
syd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:syd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Syncc9605_0990
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Syncc9605_0990
Enzymes [BR:syd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Syncc9605_0990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth ThiG ALF
Motif
Other DBs
NCBI-ProteinID: ABB34748
CyanoBase: Syncc9605_0990
CYORF: Syncc9605_0990
UniProt: Q3AKY4
Position
944001..944873
Genome map
AA seq 290 aa AA seqDB search
MRPPSTHRLSKFVPGRLTEMPNQQSSSIAQRFEQLKQDGRLALMPFLMAGDPDLAVTADV
LLSLQMAGADMVELGMPYSDPLADGPVIQAAASRALAAGTTPTGVLDMLQSLKGQLQIPV
ILFTYSNPLLNVGMEAFCQSAAEAGAAGLVVPDLPLEEAERLSTIAERHGLDLVLLVAPT
TPQDRMGRIAKCSRGFTYLVSVTGVTGERAQMESRVEGLVQQLKQTSPVPVAVGFGISGA
EQVRQVRGWGSDGAIVGSALVKRMAAASPGEIAQEAGRFCAELRAAADQP
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcccccgtcgactcataggctttcgaagtttgttcctggtcggttgaccgagatg
cccaatcagcagtcctcttccatcgcccagcgctttgagcagctgaagcaggacggtcgc
cttgccttgatgccattcctgatggctggcgatcctgatctcgcggtcaccgctgatgtg
cttctcagtctgcaaatggcaggggccgacatggtggaactggggatgccgtacagcgac
ccgctcgcggatgggccggtcattcaggccgctgcgtcccgtgcccttgctgccggaacc
acgccaacgggcgtgctggacatgctgcagtcgttgaagggtcagctgcagatcccggtg
atcctgttcacgtattccaatccactgctcaatgtggggatggaggcgttctgccagtct
gcagcggaggctggtgcggcgggtttggtggtgcctgatctccccctcgaggaggccgag
cggttgtcaaccatcgccgagcgtcatggcttggatttggtgctcttggttgcacccacc
actcctcaagatcggatgggtcggattgccaaatgcagccgtggtttcacctatctggtg
agtgtcactggcgtcaccggtgagcgagctcagatggaaagcagggttgaaggtttggtg
cagcaactcaaacaaacctctccggttcctgttgcggttggtttcggtatctctggggcg
gagcaggtgcgacaggttcggggctggggttccgatggagcgattgtgggcagcgcgctc
gtgaagcggatggctgcagcatcgccaggagaaattgcacaggaagctggtcgtttttgc
gctgagctgcgtgccgcggcggatcagccttaa

DBGET integrated database retrieval system