KEGG   Synechococcus sp. CC9605: Syncc9605_1839Help
Entry
Syncc9605_1839    CDS       T00292                                 

Definition
(GenBank) two component transcriptional regulator, winged helix family
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
syd  Synechococcus sp. CC9605
Pathway
syd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:syd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Syncc9605_1839
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:syd02022]
    Syncc9605_1839
Two-component system [BR:syd02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   Syncc9605_1839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C B12-binding
Motif
Other DBs
NCBI-ProteinID: ABB35584
CyanoBase: Syncc9605_1839
CYORF: Syncc9605_1839
UniProt: Q3AIJ8
Position
1677242..1678009
Genome map
AA seq 255 aa AA seqDB search
MPSHCIPSAHPLMGMSRDTMIWLVDDDPELRKMVGTYLIDQGYDVRSLCDVKQFEARLEC
QRPDLVVLDLMLPGDDGLTALRRLRDAGDDLPVVMLTARADGVDRIIGLEQGADDYLAKP
FLPRELTARIEAVLRRRNAMPAGTPVECGECIRFGDNQLDLSARTLLQNNQPVVITSGEF
SLLAAFVRYPHRPLSRERLIELARGPGSDTDSRSMDVQVSRVRKLVEPDPTRPRYVQTVW
GYGYVFVPDGTPRSR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgccaagccactgcataccatcagcccatccgctgatgggcatgtccagagacaccatg
atctggttggtggacgacgacccggagctgagaaagatggtcggcacttacctgatagac
cagggctacgacgtgcgcagcctctgcgatgtgaagcaattcgaggcacgtctggaatgc
caacgcccagatctggtggtcctcgacttgatgcttcccggcgacgacggattgacggca
ctgcggaggcttcgggatgccggcgatgatctgcctgttgtgatgctgaccgcgcgcgcc
gatggggttgatcggatcatcggcctcgagcaaggtgccgatgactatctggccaaaccg
ttcctgcccagggaactgacggctcgaattgaagccgtgctcaggcggcgcaatgccatg
ccggcgggaacaccggtggaatgtggggaatgcatccgctttggcgacaaccaactcgat
ctctccgcccgcaccttgctgcagaacaaccagccggtggtgatcaccagcggtgagttc
agccttctggccgcctttgtgcgttatccccatcgccccctctcgcgggaacgcctgatt
gaactggcccgaggtccagggagcgacaccgacagccgcagcatggacgttcaggtgtcg
cgggtgcgcaagctggtggaaccggatcccacccgcccgcgctatgtgcaaacggtttgg
ggctatggctacgtgtttgtgccagacggcacgccgagatcccgctga

DBGET integrated database retrieval system