KEGG   Synechococcus sp. CC9605: Syncc9605_2353Help
Entry
Syncc9605_2353    CDS       T00292                                 

Definition
(GenBank) Uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
syd  Synechococcus sp. CC9605
Pathway
syd00860  Porphyrin and chlorophyll metabolism
syd01100  Metabolic pathways
syd01110  Biosynthesis of secondary metabolites
syd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:syd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Syncc9605_2353
Enzymes [BR:syd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Syncc9605_2353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 B12-binding
Motif
Other DBs
NCBI-ProteinID: ABB36085
CyanoBase: Syncc9605_2353
CYORF: Syncc9605_2353
UniProt: Q3AH47
Position
2165443..2166240
Genome map
AA seq 265 aa AA seqDB search
MSHPLQGRTVVVTRAADQQGAARQLLEQQGATVLDLPALVIGPPDHWGPLDDALEDLDSF
HWLVFSSANGVQAVEQRLQRLGRCLARRPASLKIAAVGRKTAQMLDDLGASADFVPPSFV
ADSLIDHFPVSGWGLKMLLPRVQSGGRTLLADAFGEAGVRVVEVAAYESCCPVAMPEPTA
TALDEGKVDAIAFSSGKTAQHTAKLLEQRFGAGWAERLEGVKVVSIGPQTSRSCRQCFGR
VDAEADPHDLEGLADACAQAMQKGS
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
ttgagccatcccttgcagggccgaacggtggtcgtcacccgcgcggccgaccagcagggg
gccgctcgccagctgctggagcagcagggggcaacagtgctagaccttcctgccctggtg
atcggaccacccgaccactgggggcctctggatgacgccctcgaagacttggacagcttt
cactggctggtgttctccagcgccaatggcgttcaggccgtggaacagcggctgcagcgc
ctcggccgttgcctggcccgacgccccgccagcctcaagattgcggcggtgggccgcaaa
acggcgcagatgctggacgatctgggggcgagcgctgatttcgtgccacccagcttcgtg
gccgacagcttgatcgatcacttcccggtgtcgggctggggtctcaagatgcttttgcca
cgggttcagagcggtggtcgcaccctgctggcggacgccttcggtgaagcaggagtgagg
gtggtggaggtggcggcctatgagtcctgctgccccgtcgcaatgccggagccaacagcg
accgccctggacgagggcaaggtcgatgccattgccttcagcagcggcaagaccgctcag
cacaccgcgaagctgctggaacaacgcttcggtgccggctgggccgaacggttggagggg
gtgaaggtggtttcgataggcccccagaccagccgcagctgccgccaatgcttcggtcgg
gtggatgctgaggccgacccccacgatctcgaaggattagccgatgcctgcgctcaagcc
atgcagaagggatcatga

DBGET integrated database retrieval system