KEGG   Synechococcus sp. CC9902: Syncc9902_0026Help
Entry
Syncc9902_0026    CDS       T00293                                 

Definition
(GenBank) glyceraldehyde 3-phosphate dehydrogenase (NADP+)
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
sye  Synechococcus sp. CC9902
Pathway
sye00010  Glycolysis / Gluconeogenesis
sye00710  Carbon fixation in photosynthetic organisms
sye01100  Metabolic pathways
sye01110  Biosynthesis of secondary metabolites
sye01120  Microbial metabolism in diverse environments
sye01130  Biosynthesis of antibiotics
sye01200  Carbon metabolism
sye01230  Biosynthesis of amino acids
Module
sye_M00002  Glycolysis, core module involving three-carbon compounds
sye_M00165  Reductive pentose phosphate cycle (Calvin cycle)
sye_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
sye_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:sye00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Syncc9902_0026
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Syncc9902_0026
Enzymes [BR:sye01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Syncc9902_0026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N
Motif
Other DBs
NCBI-ProteinID: ABB25001
CyanoBase: Syncc9902_0026
CYORF: Syncc9902_0026
UniProt: Q3B0X7
Position
26528..27553
Genome map
AA seq 341 aa AA seqDB search
MTLRVAINGFGRIGRNVLRGWISRGADTGLEIVGMNSTSDPKTSAHLLTYDSILGRLDPS
VDIQTTDDTMIINGKEIKFFADRNPLNCPWKDWGVDLVIESTGVFNTDEKASMHIQAGAK
KVILTAPGKGAGVGTFVVGVNDDQYRHEDWNILSNASCTTNCLAPIVKVLDQNFGMEWGL
MTTIHSYTGDQRILDNSHRDLRRARAAALNMVPTTTGAAKAVALVYPEVKGKLTGFAMRV
PTPNVSAVDLTFGTSKGATVEQVQAVMKEAAENGMKGIIKYSDLPLVSTDYAGTNESTIF
DADLTYAMGDKAVKILAWYDNEWGYSQRVVDLAEVVAKNWK
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgcgcgttgcgatcaatggattcggccgaattggtcgcaatgttttgcggggt
tggatcagccgtggggcagataccggtttggaaattgtggggatgaactccacatctgat
cccaagaccagtgcccacctacttacctacgactccattttggggcgtttggatccgtct
gtcgacatccaaaccactgatgacacgatgatcatcaacggcaaagagatcaaattcttt
gctgaccgcaaccccctcaattgcccatggaaggattggggcgttgacctggtgatcgaa
tccaccggtgtcttcaacactgatgaaaaagccagcatgcatatccaggctggtgccaaa
aaagtgatcctcactgctcctggtaagggcgctggtgtgggcacatttgtggtgggcgtc
aacgacgatcagtaccgccacgaggattggaacatcctcagcaacgccagctgcaccacc
aactgtctggctccaatcgtcaaagttttggatcaaaacttcggcatggagtggggtctg
atgaccaccattcacagctacaccggtgaccagcgaattctcgacaacagccaccgcgac
ctgcgtcgtgcccgtgctgctgccctgaatatggttcccaccacaactggtgctgccaag
gccgttgccttggtttatcccgaagtgaagggcaagctcaccggttttgccatgcgcgtc
cccactccaaacgtgtcggcagttgacctcaccttcggaacatccaagggagcaactgtt
gagcaagtgcaggccgtgatgaaggaggctgctgagaacggaatgaaggggatcatcaag
tacagcgatctgcccttggtttccaccgactacgccggtaccaacgagtccaccattttt
gatgccgacctcacctacgccatgggtgacaaggctgtgaagatcttggcttggtacgac
aacgagtggggttacagccagcgtgttgttgatttggctgaagtggtcgccaaaaactgg
aagtaa

DBGET integrated database retrieval system