KEGG   Synechococcus sp. CC9902: Syncc9902_0662Help
Entry
Syncc9902_0662    CDS       T00293                                 

Definition
(GenBank) putative dihydrolipoamide acetyltransferase component (E2) of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sye  Synechococcus sp. CC9902
Pathway
sye00010  Glycolysis / Gluconeogenesis
sye00020  Citrate cycle (TCA cycle)
sye00620  Pyruvate metabolism
sye01100  Metabolic pathways
sye01110  Biosynthesis of secondary metabolites
sye01120  Microbial metabolism in diverse environments
sye01130  Biosynthesis of antibiotics
sye01200  Carbon metabolism
Module
sye_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sye00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Syncc9902_0662
   00020 Citrate cycle (TCA cycle)
    Syncc9902_0662
   00620 Pyruvate metabolism
    Syncc9902_0662
Enzymes [BR:sye01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Syncc9902_0662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: ABB25630
CyanoBase: Syncc9902_0662
CYORF: Syncc9902_0662
UniProt: Q3AZ47
Position
672042..673388
Genome map
AA seq 448 aa AA seqDB search
MATHDIFMPALSSTMTEGKIVEWLKQPGDKVARGESVLVVESDKADMDVESFQDGFLAAV
LMPAGSTAPVGETIGLIVETEAEIADAKANAPAAPAAAAAPAPTPTPAPTPAAVQASTTS
PAPAPAAPPVVTAPPVVTAPVVNDGRIVASPRAKKLASQMGVDLSTVRGSGPHGRIQAED
VEQATGQPISVPRVAEGTAPAAGGSVTSAAAPAAAAPAGNSFGRPGETVAFNTLQGAVNR
NMEASLAVPCFRVGYTITTDKLDAFYKKVKPKGVTMTALLAKAVAVTLAHHPQVNAATTA
AGMSYPADVNVAVAVAMEDGGLITPVLRQADRTDLYEMSRQWADLVKRSRSKQLLPEEYS
TGTFTLSNLGMFGVDRFDAILPPGTGAILAVAASRPMVVAGKDGSISVKRQMQVNLTADH
RVVYGADGASFLKALADLIENRPESLAL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
ttggcaacccacgacatctttatgcctgcccttagctccaccatgacggagggcaagatc
gtcgagtggctgaaacagcctggtgacaaggtcgcccgcggcgaatcagttctggtggtg
gagtcggataaggccgacatggacgttgagtcgtttcaggatggctttctggccgcggtt
ctgatgccggctggcagcacggcaccggtgggagaaaccatcggtttgatcgttgaaacc
gaggccgagattgcagacgccaaagccaatgctccagcagctccagcggctgcggcagcc
cctgcacccacacccacgccagctcctacaccagcagcggtccaagcatcaacgacgtct
cccgctccagcccccgctgccccccctgtggtgacagcgccccctgtggtgacagccccc
gttgtgaatgacggtcgcatcgtcgccagcccccgggccaaaaagcttgcctcccaaatg
ggtgtcgacctctccacggttcgtggcagtggcccccacgggcgaatccaggccgaagat
gtggaacaggccaccgggcagcccatttcagtgccgcgggtggcggaagggacggctccc
gcggctggaggatctgtcacctcagccgcagcaccggcagcagctgccccggctggtaat
agctttggccgtcccggtgagacggttgcgttcaacaccctgcagggggctgtgaaccgc
aacatggaagccagccttgctgtgccttgcttccgcgttggttacacgatcaccaccgac
aaattggatgcgttttacaaaaaggtgaagccaaagggcgtcacgatgacggcccttttg
gccaaggcagtggccgtgacgctggcccatcatccccaggtgaatgcggcaactaccgca
gctgggatgagttatcccgctgatgtgaatgtggctgtcgctgtcgcgatggaagacggg
ggcttaattacgcctgttttgcgtcaagccgaccgcactgatctctatgagatgtctcgc
caatgggccgaccttgtgaagcgatcccgtagtaagcagcttttgcctgaggaatacagc
acgggaacgttcaccctctccaatttgggcatgtttggcgtcgaccgcttcgatgcgatc
cttcccccaggcactggagcgattttggccgtggccgcatcccgtccgatggtggtggct
ggcaaggatggctccatttcggtgaaacgtcagatgcaggtgaacctcaccgctgatcat
cgggttgtctacggcgccgatggtgcttccttcctcaaggccctggctgatttgattgag
aaccgtccggagagcttggcgctctga

DBGET integrated database retrieval system