KEGG   Synechococcus sp. CC9902: Syncc9902_0748Help
Entry
Syncc9902_0748    CDS       T00293                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
sye  Synechococcus sp. CC9902
Pathway
sye00030  Pentose phosphate pathway
sye00480  Glutathione metabolism
sye01100  Metabolic pathways
sye01110  Biosynthesis of secondary metabolites
sye01120  Microbial metabolism in diverse environments
sye01130  Biosynthesis of antibiotics
sye01200  Carbon metabolism
Module
sye_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sye_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:sye00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Syncc9902_0748
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Syncc9902_0748
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sye04147]
    Syncc9902_0748
Enzymes [BR:sye01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     Syncc9902_0748
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     Syncc9902_0748
Exosome [BR:sye04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Syncc9902_0748
  Exosomal proteins of colorectal cancer cells
   Syncc9902_0748
  Exosomal proteins of bladder cancer cells
   Syncc9902_0748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ABB25716
CyanoBase: Syncc9902_0748
CYORF: Syncc9902_0748
UniProt: Q3AYW1
Position
complement(763570..765093)
Genome map
AA seq 507 aa AA seqDB search
MVATITNPLRVGLRQERVIAPQCLVIFGASGDLTHRKLVPALFELFKQRRLPSEFALLGC
ARRPWTDDVFRGKMAEALAPRIAENPAAWDQFVGKLFYEPVDLQKPEDVVRLGGRLELID
QQCATRSNRTFYLSVSPNFYASGCRALSDAGLLKDPKRSRVVIEKPFGRDYGSAQALNKV
VQTCGQENQIFRIDHYLGKETVQNIMVLRFANTIFEPIWNRNYISSVQITASETVGVEER
AGYYESSGALRDMVQNHLTQMLAITAMEPPGRFDPEAIRNEKAKVLQAAHLADELEPWNC
CVRGQYGPGGTKDNPLAGYRQEPGVEPNSTTETYVAMKLFIDNWRWQGVPFYVRTGKRLA
KRLSEVVLTFREAPVHLFDAATGGPTANQLILRIQPDEGAEFRFEVKSPGSGMRSRPIDM
EFSYDESFGEPSDEGYVRLLADAMLSDPTLFTRADEVEAAWRLYTPLLELIEDSPWQLPI
HPYESRTWGPAAADALLARDGLLWRRP
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccacgatcaccaatccgctccgcgttggacttcgacaggaacgggtcattgca
ccgcaatgtttggtgatttttggagccagcggcgatttaacccaccgcaaacttgtgccg
gcgttgttcgaactgttcaaacaacgccgactccccagtgaattcgctcttttgggttgc
gcccgtcgcccttggaccgatgacgtgtttcggggaaaaatggctgaagcactcgccccc
cgcattgcagagaatccagcggcgtgggatcaattcgtcggcaagctgttttacgaacca
gttgacctgcaaaaaccagaggatgtcgtgcggctcggcggacgccttgaactgatcgat
caacagtgcgccactcggagcaatcgcaccttctacctctcggtgtctcccaatttctat
gcaagcggttgtcgtgccctatccgatgcaggccttctgaaggatcccaaacgcagccgc
gttgtgatcgaaaagccctttggacgtgattacggcagtgcacaagccttgaacaaggtg
gttcaaacctgcggtcaagaaaatcagatcttccgcatcgaccattacctcggcaaggaa
accgtccaaaacatcatggtgctgcgatttgccaacaccattttcgagccaatctggaat
cgcaattacatctcgagcgtccaaatcaccgcctccgaaaccgttggcgtggaagaacgt
gcggggtactacgaaagctctggggccctgcgggacatggtgcaaaaccatctcacccaa
atgttggccatcacagcgatggaacccccggggcggtttgaccccgaagcgatccgcaat
gaaaaagccaaggtgctgcaagctgcccatctcgcagacgaacttgagccgtggaactgc
tgtgttcgcgggcaatatggccccggcggaacgaaggacaaccctcttgcgggatatcgc
caggagccaggggttgaaccgaacagcaccaccgagacctatgtggcgatgaagctcttc
atcgacaattggcgctggcagggggtgcccttctacgtccggacgggcaaacgactcgcc
aaacgtctcagtgaagtggtgctcaccttccgggaagcccctgtgcacctttttgatgct
gcaaccggaggacccaccgcgaaccagctgattttgcgcatccaaccggatgagggtgcc
gaattccgcttcgaagtgaagtctccaggttctggcatgcgcagtcggccgatcgacatg
gagttctcctacgacgagtcgtttggagagccctctgatgagggctatgtgcgcttgctg
gccgatgccatgctcagcgacccaaccctgttcacccgtgccgacgaggtggaagcggct
tggcgcctgtacacaccgctgctcgagctgattgaagacagcccctggcaactgccgatc
catccctacgaatcgcgcacctgggggccagccgccgccgatgctctgctcgcccgtgac
gggttgctttggcgacggccttaa

DBGET integrated database retrieval system