KEGG   Synechococcus elongatus PCC7942: Synpcc7942_0670Help
Entry
Synpcc7942_0670   CDS       T00300                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
syf00240  Pyrimidine metabolism
syf00250  Alanine, aspartate and glutamate metabolism
syf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syf00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Synpcc7942_0670
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Synpcc7942_0670
Enzymes [BR:syf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Synpcc7942_0670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ABB56702
CyanoBase: Synpcc7942_0670
CYORF: Synpcc7942_0670
UniProt: Q31QG7
Position
665121..666137
Genome map
AA seq 338 aa AA seqDB search
MSDWQRRHILSLADFSPVEYEMVLRTAAGFAEVLQRRNKKVPTLQGQVVTTLFFEPSTRT
RSSFELAAKRLSADTINFAASSSSLSKGETILDTARTYLAMGSDIMVVRHAQAGVPQAIA
REMERLGTEVRVLNAGDGQHEHPSQALLDLFTICSVIQPEQPSLGAIAGKKIAIVGDILH
SRVARSNIWSLTAAGAEVHLAAPPTLLPPEFAQFANTPIPGSGLPRQLQIHWQLESALEN
ADFVMTLRLQQERMSQSLLPSLREYHREFGLTRDRLRVCQPSVKLLHPGPVNRGVELSSD
LMEDESISLIQPQVTNGVAVRMALLYLIGAAVPAAIPA
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgattggcaacgtcgacacattctgtcgttagcagactttagccctgtcgaatat
gaaatggtgttgcgtacagcggcgggctttgctgaggttctgcagcggcgtaataaaaaa
gtgccgaccttgcagggacaggtggtaacgacgctgttttttgagccatcgacgcggaca
cgcagcagctttgaactggcggcaaaacggctatcggcagacacgattaactttgcggcc
agcagttcatcgctcagcaagggcgagactattctcgatacggcccgcacctatctggcg
atgggcagtgacattatggtggtgcgccatgctcaggccggcgttccccaggcgatcgcg
cgggaaatggaacggctcggcaccgaggtgcgggtactcaatgccggtgacggtcagcac
gagcatccctcgcaagcgctgttggatttgttcacaatctgcagtgtgattcagccggag
caaccgagtctgggtgcgatcgcgggcaagaaaattgcgatcgtcggcgatatccttcac
tcgcgggtggcacgatcgaacatttggagcctgacggcggccggggctgaggtgcattta
gccgctccaccgacgttattgcctccagagtttgcccagtttgctaataccccaattcct
ggcagtggattgccgcgccagctccagattcactggcaactagagtccgcattggaaaac
gctgattttgtgatgactctgcgcctgcaacaggagcggatgagtcagtcgctcctgccg
agtttgcgggaatatcatcgggagtttggcctaacgcgcgatcgcctgcgggtctgccag
ccaagcgtgaaactcctccatcccgggccggtcaaccgaggcgtggaactcagctctgac
ctgatggaagacgagtcgatcagtctgattcagccgcaagtcaccaatggagttgctgtc
cgcatggctttgctgtacctgattggggcagcggtacccgctgcaattccggcctag

DBGET integrated database retrieval system