KEGG   Synechococcus elongatus PCC7942: Synpcc7942_0846Help
Entry
Synpcc7942_0846   CDS       T00300                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
syf00010  Glycolysis / Gluconeogenesis
syf01100  Metabolic pathways
syf01110  Biosynthesis of secondary metabolites
syf01120  Microbial metabolism in diverse environments
syf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:syf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Synpcc7942_0846
Enzymes [BR:syf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Synpcc7942_0846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABB56877
CyanoBase: Synpcc7942_0846
CYORF: Synpcc7942_0846
UniProt: Q31PZ2
Position
complement(840263..841081)
Genome map
AA seq 272 aa AA seqDB search
MMEDTFTPLQLQVEGASLRFCRYGGQVLSWQPADGQERLFLSDRSLYQSGQAIRGGVPII
FPQFSGRGSLPKHGFARDRAWALLQWDEDSGQAELELRESLETLQIWPFAFRLVLKLQLR
PQQLQLQLTVENCDRQPWSFTAALHSYLAVPDLATVHLQGLQGRWGTEQTTGDRWQEMEC
DRHFPQAIDALYEAPAQPLTLLAPPWSALQICQTGFTETVIWNPGSAGVSQIGDLASGSE
QQFLCVEAAVVQSPPRLEPGEIWQGQQVFQVG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgatggaagatacgtttacgccgttacagctccaggttgaaggggcgagcctgcggttc
tgtcgctacggtgggcaagtattgtcctggcaacccgccgatggtcaagagcgcctattc
ctgagcgatcgcagtctttaccagtccggtcaggcgattcgcggtggcgtcccgatcatc
tttccccagttctcggggcgcgggtcattgcctaagcatggttttgcccgcgatcgcgct
tgggctttgctgcagtgggatgaggacagcggccaagccgagttagagctccgagagtca
ctagaaaccttacagatttggccgtttgcttttcggttggtgctcaagctgcaactccga
ccccagcaactgcagctgcaactcactgttgagaactgcgatcgccaaccttggtcgttt
acagcagcactgcacagctatctagcggtgccggatctggccactgtgcatctacaagga
ctgcaagggcgttggggcacggaacaaaccacgggcgatcgctggcaggagatggagtgc
gatcgccacttccctcaagcgatcgatgcgctctacgaggctccggcgcagcccttgacc
ttgctggctcctccttggtcagcccttcagatctgtcagacagggtttaccgaaacagtg
atctggaacccggggtcagcaggggtcagtcagattggcgatctggcctccggctcagaa
cagcagtttctctgtgtggaagcagctgtcgtgcagtctcctccccgccttgaacctggg
gaaatttggcaggggcaacaagtctttcaggtcggttga

DBGET integrated database retrieval system