KEGG   Synechococcus elongatus PCC7942: Synpcc7942_1313Help
Entry
Synpcc7942_1313   CDS       T00300                                 

Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
syf00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:syf00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Synpcc7942_1313
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:syf01007]
    Synpcc7942_1313
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:syf03016]
    Synpcc7942_1313
   03029 Mitochondrial biogenesis [BR:syf03029]
    Synpcc7942_1313
Enzymes [BR:syf01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     Synpcc7942_1313
Amino acid related enzymes [BR:syf01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   Synpcc7942_1313
Transfer RNA biogenesis [BR:syf03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Synpcc7942_1313
 Prokaryotic Type
   Other AARSs
    Synpcc7942_1313
Mitochondrial biogenesis [BR:syf03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Synpcc7942_1313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2b
Motif
Other DBs
NCBI-ProteinID: ABB57343
CyanoBase: Synpcc7942_1313
CYORF: Synpcc7942_1313
UniProt: Q31NM6
Position
1340634..1342433
Genome map
AA seq 599 aa AA seqDB search
MRTHYCGELRAEQVGTSVTLYGWVDRRRDHGGVIFVDLRDRTGTVQIVSDPERTPESYHQ
AEGLRNEYVVKITGRVSGRPAESLNPKLPTGEVEIYADRIEILNAVRRQLPFQVSSADEE
TVREDLRLRYRYLDLRRDRMNRNLQLRHQVVKAIRRFLEDEEQFIEIETPVLTKSTPEGA
RDYLVPSRVNPGEWFALPQSPQLFKQLLMVSGFDRYYQIARCFRDEDLRADRQPEFTQLD
MEMSFLSQEEIIDLNERLIAHIFKTVKGIELPRPFPRLTYAEAMDRYGSDRPDTRFGLEL
VDVSDVVADMGFKVFSGAVKSGGKVKILPIPDGNDRISNVRIKPGGDIFKEATEAGAAGL
AYIRVRENGEIDTIGAIKDNLSDEQKAEILRRTQAQPGTLLLFGAGSTDIVNKSLDRVRQ
FLGKELGLIDPEALNLLWVVDFPMVEWNADEKRYEALHHPFTAPNPQDLEDLTTARAQAY
DIVLNGLEIGGGSLRIYQRDIQERVFETIGLSHEEAQAKFGFLLEAFDFGTPPHGGIAYG
LDRLVMLLTGEESIRDAIAFPKTQQARCLLTEAPADVSDRQLKELYVASTWQPPIKERD
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgcgcactcactactgcggcgaacttcgtgccgagcaagttggcacctccgtcacgctc
tatggctgggtcgatcggcgtcgggatcatggtggcgtgatctttgtcgatctgcgcgat
cgcacaggcacggtgcaaatcgttagtgatccagaacggacgccggagtcttaccaccaa
gccgaaggcctgcgcaacgagtatgtggtaaaaatcaccggacgggtcagcggtcggccg
gcggaatccctcaacccgaagctgccaacgggcgaagtagaaatctacgctgatcgcatt
gaaattctgaacgcagtccgccgtcagttgcccttccaagtttccagcgccgatgaagag
acggtgcgggaagatttgcggctgcgctaccgctacttggatctgcgccgcgatcgcatg
aaccgcaatctgcagctgcgtcaccaagtcgtcaaggcgattcgccgcttcttggaagat
gaagaacaatttatcgagattgaaacacccgtcctgaccaagtcgacgccggaaggcgca
cgggattacttggtgccctcgcgggtcaatccgggcgaatggtttgccctgccgcaatca
ccgcagctgtttaagcaactgctgatggtgtcggggttcgatcgctactaccaaattgcc
cgctgcttccgcgatgaggatttgcgcgccgatcgtcagccggaatttacccagctcgat
atggaaatgagcttcctctcccaggaagaaatcatcgacctgaacgagcggctgattgct
cacatcttcaaaacagtgaagggtattgagctgccgcgacccttcccgcgcttgacctac
gctgaggcgatggatcgctacggcagcgatcgccccgacacgcgctttggcctagagctg
gtggatgtttccgatgtcgttgcggacatgggcttcaaggtcttcagtggcgcagtcaaa
tccggcggcaaggtcaaaatcctgccgattcccgatggcaacgatcgcatttccaacgtg
cggatcaagcccggcggcgacatcttcaaagaagccacggaagccggtgctgccggtctg
gcctacattcgcgtccgtgaaaacggcgagatcgacacgattggcgcgatcaaagacaac
ctcagtgatgagcagaaagctgagatcctccgtcgcactcaggcacaacccggaacgctg
ttgctatttggagcagggagcaccgacatcgtcaacaagtccctcgatcgcgtccgccaa
ttcttgggtaaagagttgggattgatcgatcccgaggcactcaacttgctctgggtcgtg
gacttcccgatggtcgagtggaatgccgatgagaagcgctacgaagcgctacaccacccc
ttcacggcccccaatcctcaagatctagaagacctgacaacggcgcgagcccaagcctac
gacatcgtcctcaatggcttggaaattggcggcggtagtctgcggatttaccaacgcgac
attcaagaacgggtgtttgaaacgatcggcctgtcccacgaggaagcccaagctaaattt
ggattcctactggaagccttcgactttggtactccaccccacggcggcatcgcctacggt
ctcgatcgccttgtgatgttgctgaccggcgaagaatcgatccgtgatgcgatcgccttc
ccgaaaacgcagcaagcccgctgtctgttgaccgaagcgccggctgatgtcagcgatcgc
cagctcaaagaactctacgtcgcctccacttggcaaccgccgatcaaagaacgcgactaa

DBGET integrated database retrieval system