KEGG   Synechococcus elongatus PCC7942: Synpcc7942_1352Help
Entry
Synpcc7942_1352   CDS       T00300                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
syf00010  Glycolysis / Gluconeogenesis
syf00620  Pyruvate metabolism
syf00640  Propanoate metabolism
syf00680  Methane metabolism
syf01100  Metabolic pathways
syf01110  Biosynthesis of secondary metabolites
syf01120  Microbial metabolism in diverse environments
syf01130  Biosynthesis of antibiotics
syf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Synpcc7942_1352
   00620 Pyruvate metabolism
    Synpcc7942_1352
   00640 Propanoate metabolism
    Synpcc7942_1352
  Energy metabolism
   00680 Methane metabolism
    Synpcc7942_1352
Enzymes [BR:syf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Synpcc7942_1352
Lipid biosynthesis proteins [BR:syf01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Synpcc7942_1352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABB57382
CyanoBase: Synpcc7942_1352
CYORF: Synpcc7942_1352
UniProt: Q31NI7
Position
1383192..1385162
Genome map
AA seq 656 aa AA seqDB search
MSQPTIESILQEKRVFPPSAEFASAARINPEAYEALCQKAAADPVAFWGELAAQELDWFE
PWQQTLDWSNPPFAKWFVGGKLNISHNCLDRHLTTWRKNKAAIIWEGEPGDSRTLTYAQL
HREVCQFANVLKSLGIQKGDVVGVYMPMIPEAAIAMLACARIGAVHSVVFGGFSAEALRD
RLVDGQAKLVVTADGGWRKDAIVPLKDSVDQALEGNACPSVQHVLVVERTKQDIHMEPGR
DHWWHELQQTVSATCPAEPMDSEDLLFVLYTSGSTGKPKGVVHTTGGYNLYAHITTQWTF
DLQDTDVYWCTADVGWITGHSYIVYGPLSNGATTLMYEGAPRASNPGCFWDVIEKYGVTT
FYTAPTAIRAFIKMGEQHPAARDLSSLRLLGTVGEPINPEAWIWYHRVIGGDRCPIVDTW
WQTETGGHMITSLPGAVPTKPGSATKPFPGILADVVDLDGRSVPDNEGGYLVIRHPWPGM
MRTVYGDPDRFRRTYWEHIPPQNGQYLYFAGDGARRDADGYFWVMGRVDDVINVSGHRLG
TMEIESALVSHPAVAEAAVVGRPDDLKGEGIVAFITLESGIETGDELVKDLKKHVAQEIG
AIARPDEIRFSEALPKTRSGKIMRRLLRSLAAGQEVSGDTSTLEDRSVLDKLRQGT
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgagccagccaacgatcgagtcgatcctccaagagaagcgggtttttcctccctcggca
gaatttgccagtgcggcgcgaatcaatcccgaagcgtacgaagcgctctgccagaaagcg
gcggccgatccggtggctttttggggcgaattggcagctcaggagctggactggtttgag
ccttggcaacagacgctggactggagcaatccgccgtttgcgaagtggtttgtcggtggc
aaactcaatatttcccacaactgcctcgatcgccacttgacgacttggcgcaaaaataaa
gcggcgattatctgggaaggcgaacccggtgactcacggacgctgacctacgcgcaactg
catcgcgaggtctgtcagttcgccaacgtgctcaaatccttgggcattcaaaaaggtgat
gtcgttggcgtttacatgccgatgattcccgaagcggcgatcgccatgctggcctgtgcg
cggattggcgcagtgcatagcgttgtctttgggggctttagtgcggaagcactgcgcgat
cgcttggtggatggccaagccaagctggttgtcacggcggatggtggctggcgcaaagat
gcgatcgtgcccctcaaggattctgttgatcaagccctggaaggcaatgcctgccccagc
gtccagcatgtcctcgtggtggaacggacgaagcaagacatccacatggaaccggggcgc
gaccattggtggcatgagctgcaacagaccgtcagcgctacctgtccggcggagccgatg
gacagcgaagatctgctcttcgtgctctacacctccggtagcaccggcaaacccaagggt
gtcgtccacaccaccggcggctacaacctctacgcccacatcaccacccagtggactttt
gacctgcaggataccgatgtctactggtgtacggcggacgtcggctggattaccggtcac
agctacatcgtctacgggccgctctccaacggtgcgaccacactgatgtatgagggtgcc
ccccgcgcttctaatcccggttgcttctgggatgtgattgaaaagtatggcgttacgacc
ttctacacagccccaacagcgatccgcgccttcatcaaaatgggtgagcagcatcccgcc
gctcgcgacctctcctcattgcgactgttgggcaccgtcggagagcccatcaatcccgaa
gcttggatctggtatcaccgcgtcattggtggcgatcgctgcccgattgtcgatacctgg
tggcagaccgaaacgggcggccatatgattacgtcgctgccgggagccgtgccgaccaaa
ccgggctctgccactaaacctttcccgggcatcttggcagacgttgtcgatctggatggg
cgatcggtgccggataacgaaggtggctacttggtgattcgccatccttggccaggcatg
atgcgcacggtctacggcgatcccgatcgcttccgtcgcacctattgggagcatattcct
ccgcaaaatggccagtatctctacttcgccggcgatggcgcgcgccgcgatgccgatggc
tatttctgggtgatggggcgcgtcgatgacgtgatcaatgtctcaggtcaccgtctcggc
acgatggaaattgagtcggccttggtctcccatccggcagttgccgaagctgcagttgtc
ggtcggcctgacgatctcaaaggtgaaggcattgttgctttcatcacgctggaatcgggc
attgagactggcgatgagttagttaaagacctgaagaaacacgtcgcccaagaaattggc
gcgatcgctcgtcccgatgaaattcgcttcagtgaggcgctgcccaaaacgcgatcgggc
aagattatgcgccgtctgttgcgcagtctcgccgctggtcaagaagtttcgggcgacact
tccaccttggaagatcgctcggtgctcgataagctgcgtcaaggcacttag

DBGET integrated database retrieval system