KEGG   Synechococcus elongatus PCC7942: Synpcc7942_1427Help
Entry
Synpcc7942_1427   CDS       T00300                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
syf00630  Glyoxylate and dicarboxylate metabolism
syf00710  Carbon fixation in photosynthetic organisms
syf01100  Metabolic pathways
syf01110  Biosynthesis of secondary metabolites
syf01120  Microbial metabolism in diverse environments
syf01130  Biosynthesis of antibiotics
syf01200  Carbon metabolism
Module
syf_M00165  Reductive pentose phosphate cycle (Calvin cycle)
syf_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
syf_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Synpcc7942_1427
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Synpcc7942_1427
Enzymes [BR:syf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Synpcc7942_1427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ABB57457
CyanoBase: Synpcc7942_1427
CYORF: Synpcc7942_1427
UniProt: Q31NB2
Structure
PDB: 

Position
1480970..1481305
Genome map
AA seq 111 aa AA seqDB search
MSMKTLPKERRFETFSYLPPLSDRQIAAQIEYMIEQGFHPLIEFNEHSNPEEFYWTMWKL
PLFDCKSPQQVLDEVRECRSEYGDCYIRVAGFDNIKQCQTVSFIVHRPGRY
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgaaaactctgcccaaagagcgtcgtttcgagactttctcgtacctgcctccc
ctcagcgatcgccaaatcgctgcacaaatcgagtacatgatcgagcaaggcttccacccc
ttgatcgagttcaacgagcactcgaatccggaagagttctactggacgatgtggaagctc
cccctgtttgactgcaagagccctcagcaagtcctcgatgaagtgcgtgagtgccgcagc
gaatacggtgattgctacatccgtgtcgctggcttcgacaacatcaagcagtgccaaacc
gtgagcttcatcgttcatcgtcccggccgctactaa

DBGET integrated database retrieval system