KEGG   Synechococcus elongatus PCC7942: Synpcc7942_1597Help
Entry
Synpcc7942_1597   CDS       T00300                                 

Definition
(GenBank) GTP cyclohydrolase
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
syf00790  Folate biosynthesis
syf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Synpcc7942_1597
Enzymes [BR:syf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Synpcc7942_1597
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ABB57627
CyanoBase: Synpcc7942_1597
CYORF: Synpcc7942_1597
UniProt: Q54769
Position
1663657..1664298
Genome map
AA seq 213 aa AA seqDB search
MTSPSLNGSNSLVDAIRPETEAVSQAEMEAAVRTLLLGVGEDPEREGLLKTPKRVAEAYR
FLTSGYSQSLDDLVNGAIFDEGHNEMVLVRDITAFSLCEHHMLPFMGKVHVAYIPNQKVV
GLSKLARIVEMYSRRLQVQERLTRQIAESVQEILDPQGVAVVMEATHMCMVMRGVQKPGS
WTVTSAMVGVFQEDQRTREEFLSLIRHQPAAFA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgacttctccctccttgaatggcagcaacagcttggttgatgcgatccgccctgagacg
gaggctgtttcccaagccgagatggaagcagcagtccgcacgttgctgctcggggtcgga
gaagatccagagcgggaagggctcctgaaaaccccgaaacgggtcgctgaggcctatcgc
tttttgaccagcggctacagccaatccctggatgacttggtcaacggcgccatcttcgac
gaaggtcacaacgaaatggtgttggtgcgtgacatcaccgccttcagcctttgtgaacac
cacatgctgccgttcatgggcaaagttcacgtcgcttacatccccaaccaaaaggttgtc
ggcctgagcaaactggctcgcatcgtcgagatgtacagtcgccgtctgcaggtgcaagag
cgcctgacccgccagattgctgagtcggtgcaggaaatcctcgacccgcaaggtgtggcc
gtcgtcatggaagccacccacatgtgcatggtgatgcgcggtgtccaaaagccgggctct
tggaccgtgaccagcgccatggtcggtgttttccaagaggatcaacgcacccgcgaggaa
ttcctcagcctgattcgccatcaacctgccgcatttgcctaa

DBGET integrated database retrieval system