KEGG   Synechococcus elongatus PCC7942: Synpcc7942_1792Help
Entry
Synpcc7942_1792   CDS       T00300                                 

Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
syf00860  Porphyrin and chlorophyll metabolism
syf01100  Metabolic pathways
syf01110  Biosynthesis of secondary metabolites
syf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:syf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Synpcc7942_1792
Enzymes [BR:syf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Synpcc7942_1792
Exosome [BR:syf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Synpcc7942_1792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD Exc
Motif
Other DBs
NCBI-ProteinID: ABB57822
CyanoBase: Synpcc7942_1792
CYORF: Synpcc7942_1792
UniProt: P43087
Position
1863290..1864270
Genome map
AA seq 326 aa AA seqDB search
MFPTHRPRRLRSSETLRRMVRETTLTSADFIYPLFAVPGEGVAKEVTSMPGVYQLSIDKI
VEEAKEVYDLGIPSIILFGIPTDKDNDATGAWHDCGIVQKAATAVKEAVPELIVAADTCL
CEYTPHGHCGYLEVGDLSGRVLNDPTLELLRKTAVSQAKAGADIIAPSGMMDGFVATIRD
ALDEAGFSDTPIMAYSAKYASAYYGPFRDAAESTPQFGDRRTYQMDPGNSREALKEVELD
VAEGADIVMVKPALSYMDIICRIKETTDLPVAAYNVSGEYSMVKAAALNGWIDEERVVLE
TLTSFKRAGADLILTYHAKDAARWLA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgttccccacgcatcgtccccgtcgcctgcgatcgtccgaaactctgcgccggatggtg
cgcgaaacgacgttgacttcggccgacttcatctatcccttgtttgcggtgcccggtgag
ggcgtcgccaaggaagtaacctcgatgcctggcgtctatcaactgtcgatcgacaagatc
gtggaagaggccaaggaggtctatgaccttggcattccctcgatcattctgtttggcatt
cccaccgacaaagacaacgatgcaaccggcgcttggcacgactgcggcatcgttcagaag
gccgcaaccgctgtcaaagaagcagtgcctgagctgattgttgccgctgacacctgcctg
tgcgagtacacgccccatggccactgcggctatctggaagtaggtgatctctccggtcgc
gtcctcaatgatccgactttggaattgctgcgcaaaacagcggtgtctcaggccaaagca
ggagctgacatcattgccccttccggcatgatggacggttttgtcgccacgattcgcgat
gccttggatgaagcgggctttagcgatacgccgatcatggcctactcggctaagtatgcg
tcggcttactacggtcctttccgcgatgcggcggaatcaactccacaatttggcgatcgc
cgcacctatcaaatggatccgggcaacagccgcgaagcgctcaaggaagtcgaacttgac
gtggccgagggtgctgacatcgtcatggtcaaaccagccctctcctacatggacattatc
tgccggatcaaagaaaccactgacttgccggtcgccgcttacaacgtttctggcgagtat
tcgatggtcaaagcggcagcactcaatggctggatcgatgaagagcgggttgtactagaa
accctgactagcttcaagcgggctggggctgatctaatcctgacctaccacgccaaggat
gcagctcgctggctcgcctag

DBGET integrated database retrieval system