KEGG   Synechococcus elongatus PCC7942: Synpcc7942_2029Help
Entry
Synpcc7942_2029   CDS       T00300                                 

Definition
(GenBank) glucose-6-phosphate isomerase
  KO
K01810  glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
syf00010  Glycolysis / Gluconeogenesis
syf00030  Pentose phosphate pathway
syf00500  Starch and sucrose metabolism
syf00520  Amino sugar and nucleotide sugar metabolism
syf01100  Metabolic pathways
syf01110  Biosynthesis of secondary metabolites
syf01120  Microbial metabolism in diverse environments
syf01130  Biosynthesis of antibiotics
syf01200  Carbon metabolism
Module
syf_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
Brite
KEGG Orthology (KO) [BR:syf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Synpcc7942_2029
   00030 Pentose phosphate pathway
    Synpcc7942_2029
   00500 Starch and sucrose metabolism
    Synpcc7942_2029
   00520 Amino sugar and nucleotide sugar metabolism
    Synpcc7942_2029
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:syf04147]
    Synpcc7942_2029
Enzymes [BR:syf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.9  glucose-6-phosphate isomerase
     Synpcc7942_2029
Exosome [BR:syf04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Synpcc7942_2029
  Exosomal proteins of other body fluids (saliva and urine)
   Synpcc7942_2029
  Exosomal proteins of colorectal cancer cells
   Synpcc7942_2029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGI HTH_AsnC-type HTH_24 HTH_11 HTH_15 HTH_7
Motif
Other DBs
NCBI-ProteinID: ABB58059
CyanoBase: Synpcc7942_2029
CYORF: Synpcc7942_2029
UniProt: Q31LL0
Position
2097799..2099385
Genome map
AA seq 528 aa AA seqDB search
MTAQQLWQRYLDWLYYDPSLEFYLDISRMGFDDAFVTSMQPKFQHAFAAMAELEAGAIAN
PDEQRMVGHYWLRDPELAPTPELQTQIRDTLAAIQDFALKVHSGVLRPPTGSRFTDILSI
GIGGSALGPQFVSEALRPQAALLQIHFFDNTDPAGFDRVLADLGDRLASTLVIVISKSGG
TPETRNGMLEVQSAFAQRGIAFAPQAVAVTGVGSHLDHVAITERWLARFPMEDWVGGRTS
ELSAVGLLSAALLGIDITAMLAGARQMDALTRHSDLRQNPAALLALSWYWAGNGQGKKDM
VILPYKDSLLLFSRYLQQLIMESLGKERDLLGKVVHQGIAVYGNKGSTDQHAYVQQLREG
IPNFFATFIEVLEDRQGPSPVVEPGITSGDYLSGLLQGTRAALYENGRESITITVPRVDA
QQVGALIALYERAVGLYASLVGINAYHQPGVEAGKKAAAGVLEIQRQIVELLQQGQPLSI
AAIADDLGQSEQIETIYKILRHLEANQRGVQLTGDRHNPLSLIASWQR
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccagcagctctggcaacgctacctcgattggctctactacgatccctcgctg
gagttttacctcgacatcagccgcatgggattcgatgacgctttcgttactagcatgcag
cccaagttccagcacgcctttgcggcgatggcagagctcgaggccggagcgatcgccaac
cccgatgaacagcggatggtcggccactactggctgcgcgatcctgagctggcacccaca
ccggagctgcagacccaaattcgcgacacgctggccgcgatccaagacttcgccctcaaa
gtacacagtggcgtgttgcggccacccaccggctcccgcttcaccgacattctctcaatt
ggcattggcgggtcggccctagggccgcagtttgtctcagaagccctccggcctcaagcg
gcactgctccagattcacttctttgacaacaccgatccagctggcttcgatcgcgtttta
gctgatctcggcgatcgccttgcttccaccttagtaatcgttatttccaaatctggcggc
actcccgaaacccgcaacggcatgctggaggttcagtccgcctttgcccagcgagggatt
gcctttgcgccccaagctgtcgccgtcacaggggtggggagccatctcgatcatgtagcg
atcacagaaagatggctggcccgtttccccatggaagactgggtgggcggccgcacctct
gaactatctgcagtcggtctactctcggcagccctactgggcatcgacatcaccgccatg
ctggccggggcgcggcaaatggacgccctgacccgccattccgatttgcgacaaaatccg
gcagcgctcttggctttgagctggtactgggccggcaatgggcaaggcaaaaaagacatg
gtcatcctgccctacaaggacagcctgctgctgtttagccgctatctgcagcagttgatc
atggagtcactgggcaaggagcgcgatctgctcggcaaggtagttcaccaaggcatcgcc
gtttacggcaacaaaggctcgaccgatcaacatgcctacgtccagcaactgcgcgagggc
attcctaacttctttgccacgtttatcgaggtgctcgaagaccgacaggggccgtcgcca
gtcgtggagcctggcatcaccagtggcgactatctcagcgggctgcttcaaggcacccgc
gcggcgctttacgaaaatgggcgtgagtcgatcacgattacggtgccgcgcgttgatgca
caacaggtgggggccttgatcgcgctgtatgaacgggcggtgggactctatgccagcttg
gttggcatcaatgcctatcaccagccgggggtggaagccggcaaaaaggctgctgccggt
gttctcgagatccagcgccagattgtggagttgctccaacagggacaaccactctcgatc
gcagcgatcgcagacgatttaggtcagagtgagcagattgaaacgatctacaaaatcctg
cgccatctcgaagccaatcaacgcggcgttcagttaaccggcgatcgccataatcccctc
agtctgattgcgagttggcaacgataa

DBGET integrated database retrieval system