KEGG   Synechococcus elongatus PCC7942: Synpcc7942_2285Help
Entry
Synpcc7942_2285   CDS       T00300                                 

Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
syf  Synechococcus elongatus PCC7942
Pathway
syf00561  Glycerolipid metabolism
syf00640  Propanoate metabolism
syf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Synpcc7942_2285
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Synpcc7942_2285
Enzymes [BR:syf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     Synpcc7942_2285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase AIRC PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ABB58315
CyanoBase: Synpcc7942_2285
CYORF: Synpcc7942_2285
UniProt: Q31KV4
Position
complement(2354769..2355848)
Genome map
AA seq 359 aa AA seqDB search
MLRGWGALSEAGSAIARVGQRPLVVGGDRARALVQDSLTAIASEQSLTLGWGSSLPDCSE
AVLARLQQAATEHQADCILGVGGGKALDTAKLLGHQLSLPVITVPTSAATCAAWTALANV
YTDAGAWLYDVGLDRCPELLILDFELIAQAPPRTLAAGIGDAIAKWYEASVSSGHRQETL
VVAAVQQARVLRDLLFQKSAAAIAEPGGEQWYEVVEATVLLAGVIGGLGGAQCRTVAAHA
VHNGLTHLPACHDWLHGEKVAFGILVQLRLEELQGTNPLAATARQQLLSFYADLGLPRQW
SDMGLASVSLADLQQAAILACAPESDIHHLPFAVDPDQLLAAMVSTTTPIARSNSVVAE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
gtgttacgaggctggggcgcactctcagaggcaggatctgcgatcgcccgcgttggtcag
cgtccccttgtggtgggtggcgatcgcgccagagcactcgtccaagacagtttgacggcg
atcgcttcagaacaatccctgaccctaggttggggcagcagcttgccggactgtagtgaa
gcggttttggcacggctccagcaagcagcaaccgagcatcaagctgattgcattctaggt
gtgggcggcggtaaggcgctcgatacggccaaactgctggggcatcaactgtcgctgccg
gtgatcaccgtgccgacgagtgcggcgacctgtgcggcttggacagcattggcgaatgtc
tataccgatgccggggcttggctctacgatgtcggtctcgatcgctgtcctgagttgctg
attctcgactttgaactgattgcccaagcgcccccccgcaccctagcggcgggaattggg
gatgcgatcgccaagtggtacgaagcttccgtcagcagtggtcatcgccaagaaactttg
gtcgttgcggcggttcagcaagctcgtgtcctgcgtgatctgctcttccagaaatcggct
gccgcgatcgcggaacctggcggtgagcaatggtacgaagtggtggaagccaccgtttta
cttgcaggcgtgattggggggttaggtggggcgcaatgccgcacggtggctgcccatgct
gtccacaatggcttgacccatctgcccgcttgtcatgattggctgcacggcgagaaggtt
gccttcggtattttggtgcagttgcgtttagaagaactgcaaggcaccaacccgctggca
gcaaccgcacggcaacaactgctgagcttctatgccgatctggggctgccgcgccaatgg
tctgacatgggcttagcgtccgtcagcttagcggatttgcagcaagcggcaattctggcc
tgtgcgcccgagtcggacattcaccacctgccttttgcggtggatcctgatcagcttttg
gcggcgatggtttccacgactaccccgatcgcccgcagcaacagtgtggtggctgaatga

DBGET integrated database retrieval system