KEGG   Synechococcus sp. CC9311: sync_0293
Entry
sync_0293         CDS       T00390                                 
Symbol
amt
Name
(GenBank) ammonium transporter
  KO
K03320  ammonium transporter, Amt family
Organism
syg  Synechococcus sp. CC9311
Brite
KEGG Orthology (KO) [BR:syg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syg02000]
    sync_0293 (amt)
Transporters [BR:syg02000]
 Other transporters
  Pores ion channels [TC:1]
   sync_0293 (amt)
SSDB
Motif
Pfam: Ammonium_transp
Other DBs
NCBI-ProteinID: ABI47657
CyanoBase: sync_0293
UniProt: Q0IDE4
Position
complement(303678..305150)
AA seq 490 aa
MTTAYESPNTRRKSRLQEASLLEGPMLLLQSIRGFKTNRSLLWLGCVPLALFGLGLFNLS
AHAAEMPELNAAFLANNLWLLVATILVIFMNAGFAMVEAGMCRQKNAVNILAKNLFVFAL
AVTAYWFVGYSLMYGNAIAAGWLYFNGLFFDPAVTPELISEAGLVPSVDFLFQAAFAGTA
ATIVSGLVAERVKFGEFVVFSLILTAFIYPIAGSWEWNGGWLNSVGDKEFIDFAGSSIVH
SVGAWAGLIGAMLLGPRIGKFIDGKPQAIPGHNMAIATLGALILWIGWYGFNPGSQLAMD
QWVPYVAVTTTLAAAGGAIGATVISTLTSGKPDLTMIINGILAGLVSITAGCGNLTFVGS
WVAGLIGGIIVVFAVSALDASGIDDPVGAFSVHGVCGVWGTLVVGLWGFDIQGDGSPLGL
LVGGGISQLGIQALGCAAYAIWTIVTCWIAWSVIGGLFGGIRVTEKEEVEGLDIGEHGME
AYPDFVSSGR
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgacaactgcttacgagtcgcccaacacgcgacgcaaatctcgcctccaggaggcaagt
cttttggagggcccgatgctcctccttcaaagcattcgcggttttaaaaccaatcgctca
ctcttgtggcttggctgcgtgccactggcccttttcggtcttggacttttcaacctctcg
gctcatgccgcagagatgccggaactcaatgcagcgtttttagccaacaatctttggctg
ctcgtagcgacaattctggtgattttcatgaacgccggtttcgccatggtcgaagccgga
atgtgccgccaaaagaatgcggtcaatattctcgctaaaaatctgtttgttttcgcgctt
gcagtaaccgcctactggttcgttggctattcgttgatgtatggcaatgccattgccgct
ggatggctctatttcaacgggttgttttttgatccagctgttacgcccgaactgatttca
gaagccggccttgttccaagtgttgacttcttgtttcaggctgctttcgctggaacagca
gcaaccatcgtttcaggcctcgtcgctgagcgcgtgaaatttggcgaattcgtggtgttt
tcgctcattctcactgcattcatctatcccattgcgggtagttgggaatggaatggaggc
tggctgaactccgttggtgacaaagaatttatcgattttgctggttcatccattgttcac
tccgttggagcctgggctggactgattggagccatgcttcttggccctcgtatcggcaaa
ttcattgatggcaagcctcaggcgatcccaggccacaacatggccattgccactcttggt
gcactgattctttggattggctggtatggattcaaccctggttcccagctcgccatggat
cagtgggtcccttacgttgctgtaacgacaaccttggcggcggctggtggagcgatcggt
gccaccgtgatctcaaccctgacctccggcaagcctgacctgaccatgatcatcaacggc
atccttgccggcctggtgagcatcacggcaggttgcggcaacctcacctttgttggctcc
tgggttgctggtctgatcggcggaatcatcgttgtctttgccgtatcagcgcttgacgca
tcaggcattgacgatccggttggagccttctcagtccatggcgtgtgtggcgtctgggga
actttggtggttggtctttggggctttgacatccagggggatggctctcccctcggcttg
ctcgtcggaggtggcatcagccagctcggcatccaagcactcggttgtgcggcttatgcc
atttggacgattgtgacctgctggattgcttggtccgtgatcggtggtttgttcggaggc
atccgagtcaccgagaaggaagaagtggaaggcctggatattggtgagcacggcatggag
gcctatccagatttcgtctcatcaggccgataa

DBGET integrated database retrieval system