KEGG   Synechococcus sp. CC9311: sync_0751Help
Entry
sync_0751         CDS       T00390                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
syg  Synechococcus sp. CC9311
Pathway
syg00400  Phenylalanine, tyrosine and tryptophan biosynthesis
syg01100  Metabolic pathways
syg01110  Biosynthesis of secondary metabolites
syg01130  Biosynthesis of antibiotics
syg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:syg00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    sync_0751 (trpC)
Enzymes [BR:syg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     sync_0751 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE PA
Motif
Other DBs
NCBI-ProteinID: ABI46522
CyanoBase: sync_0751
CYORF: sync_0751
UniProt: Q0IC57
Position
702435..703319
Genome map
AA seq 294 aa AA seqDB search
MEIRRRPPNPKVQVAHLEYAVPDQDSEPRNILEKIVWEKDREIAVARERMPLEQLRRKVA
DLPPARDFLGALSAAAVRPAVIAEVKKASPSKGVIREDFDPVAIAKAYASGGASCLSVLT
DKAFFQGGFNVLIEVREAVDLPLLCKDFILSPYQLYQARAAGADAALLIAAILTDQDLAY
FAKVAAALGLTVLVEVHDAEELQRVLALGGFPLIGINNRDLTSFETDLATTETLTAQFAE
QLLEQQILLVSESGLFHRADLDRVQAAGAQAVLVGEALMRQADVEAALQSLIHG
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggagatccgccgtcgtccacccaatcccaaggtgcaagttgcgcatttggagtacgcg
gtccctgatcaggacagcgaacctcgcaatattttggaaaaaatcgtctgggaaaaagat
cgagagatcgcggttgctcgtgagcgcatgccattggagcagttgcgccgcaaggtggcc
gatttgcccccagcccgtgattttctgggcgcgttaagcgctgcagcggtgaggcctgcc
gtgattgctgaggtgaaaaaagcgagtcccagcaaaggtgtgattcgagaggatttcgat
ccagtcgcgattgccaaggcttatgcgtccggtggggcaagctgcctttcggtgctcaca
gataaagcctttttccagggtggtttcaatgtgttgattgaggtgcgcgaagccgtggat
ctcccattgctttgtaaggacttcatcctcagtccctatcagctctatcaggcgcgagca
gctggagccgatgctgcgcttttgattgcggcgatcctcaccgatcaagaccttgcctat
ttcgccaaggtggccgcagcacttggccttacggttttggtggaggtgcatgacgctgaa
gagctgcagcgggtgttggccctgggtggtttccctttgatcggaatcaacaatcgggat
ctcaccagttttgaaacggatttggcaacgactgaaacgctcacggcccaattcgcagag
cagctgttggagcagcagattcttttggtgagcgaatcgggactgttccatcgcgctgat
cttgatcgtgttcaagccgctggagcacaggctgttttggtgggtgaagctctgatgcgg
caagcggatgtggaggcagcactccaatcattgatccatggttga

DBGET integrated database retrieval system