KEGG   Synechococcus sp. CC9311: sync_1550Help
Entry
sync_1550         CDS       T00390                                 

Gene name
murI
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
syg  Synechococcus sp. CC9311
Pathway
syg00471  D-Glutamine and D-glutamate metabolism
syg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    sync_1550 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:syg01011]
    sync_1550 (murI)
Enzymes [BR:syg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     sync_1550 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:syg01011]
 Precursor biosynthesis
  Racemase
   sync_1550 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: ABI46457
CyanoBase: sync_1550
CYORF: sync_1550
UniProt: Q0I9W7
Position
1434822..1435613
Genome map
AA seq 263 aa AA seqDB search
MTIRLGLFDSGIGGLTVLRRILERHGAVPVTYLGDTARVPYGSRSPSEIRSIAAEVVAWL
RAQQVSTVVMACNTTNALARDVTEGQAGVPVVGLIGAAAALVKESRVGVLATPATVASGA
YRESIEALHPGTLVVQQACPDFVPLIEAGDLRSDELREAAIRYLQPLLEASVDSVVLGCT
HYPLLVPLLANLLPSHMRLIDPAVAVATQLDAFLGQPLPGSQNQPVSLEAAHLCVTKDAQ
GFAERATAWLGQRPCVDLVNLQP
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
ttgaccattcgtcttggactgtttgacagtggcattggcgggctcaccgtgctgcgcaga
atcctggagcgtcacggtgcagttccagtgacgtacttaggcgacaccgcccgtgttccc
tacggaagtcgctctccttcagaaatacgttcgattgcggctgaggttgtggcttggttg
agagcacaacaggtctccaccgttgtgatggcttgcaataccaccaatgctctcgccaga
gacgtcaccgagggacaagccggcgttccggttgtagggctgattggagctgccgctgct
ttggttaaagaatcgcgagttggcgttctcgccacgccagcaacggtggcctctggggcc
tatcgagagagcatcgaagcgctccatccgggaaccctggtcgtgcaacaggcttgtcca
gactttgttccactgatcgaagccggagatctccgttctgatgaacttcgtgaagcggca
attcgatatttacaacccttacttgaggcctcggttgattcggtggtgctcggctgcacc
cactacccgctgctcgttccgcttcttgcgaacttattgccatctcacatgcgtctgatc
gaccctgctgtcgccgtcgcaacgcaactcgacgcctttctgggtcaaccgttaccagga
agccaaaatcaaccggtatcactggaagcagcccatctttgcgtcacgaaagacgcccaa
gggtttgctgaaagagccacggcttggctgggccaaaggccttgcgttgatctcgtgaat
ctgcagccatag

DBGET integrated database retrieval system