KEGG   Synechococcus sp. CC9311: sync_1879Help
Entry
sync_1879         CDS       T00390                                 

Definition
(GenBank) ROK family sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
syg  Synechococcus sp. CC9311
Pathway
syg00010  Glycolysis / Gluconeogenesis
syg00052  Galactose metabolism
syg00500  Starch and sucrose metabolism
syg00520  Amino sugar and nucleotide sugar metabolism
syg00521  Streptomycin biosynthesis
syg01100  Metabolic pathways
syg01110  Biosynthesis of secondary metabolites
syg01120  Microbial metabolism in diverse environments
syg01130  Biosynthesis of antibiotics
syg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    sync_1879
   00052 Galactose metabolism
    sync_1879
   00500 Starch and sucrose metabolism
    sync_1879
   00520 Amino sugar and nucleotide sugar metabolism
    sync_1879
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    sync_1879
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    sync_1879
Enzymes [BR:syg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     sync_1879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ABI47645
CyanoBase: sync_1879
CYORF: sync_1879
UniProt: Q0I8Y9
Position
complement(1676208..1677101)
Genome map
AA seq 297 aa AA seqDB search
MINSPEVIGIDLGGTAIKLGRFSADGCLLETQQVQTPQPATPGAVCIALVEAIEALDPDR
RALIVGIGLPGPMDVGARVARVCINLPGWEDIPLADWLESRLQRRVTLANDGNCALVGEA
WQGAAMGYSDVVMLTLGTGVGGGVMLSGRLFTGHNGAAAEPGLIGLDPNGPPCNSGNQGS
LEQFACISALRRLWDGDPAALATLAANGDGEAQAVWSRYGTTLGVGISSLVYMFTPELVL
VGGGISGAASHFLPSVRKEVERRVQAVSRQGLQIEACALGNGAGRLGAARLAIERLT
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgataaattcccctgaggtcatcggaatcgatttgggtggaacggcgatcaagcttggt
cgcttttcggccgatggttgccttcttgagacacagcaggtgcagactcctcagcctgct
actccaggtgcggtttgcattgctttggtagaggcgattgaagctttagatcccgatcgc
cgagccttgatcgttgggattggtttaccgggtccaatggatgtgggggctcgtgtagcc
agggtttgcatcaacctgcctggctgggaggacattcctctcgctgattggctggagtct
cgtcttcaacgtcgggtcaccctcgccaacgatggcaactgtgccttggtcggagaggca
tggcagggagcggccatgggttattccgatgtggtgatgctcactctcggcacgggtgtg
ggtggcggcgtgatgctgtctggccgtttattcaccggtcacaatggggccgcggctgaa
ccggggctgattggtctcgatcccaacggcccaccctgcaacagcggtaatcagggcagt
ctcgaacagttcgcctgtatttctgctttgaggcggctgtgggatggagacccagcggca
ttggcaactttggctgcaaatggcgatggggaagcccaagcagtgtggtcccgttatggg
accacacttggcgtaggaatcagctcgttggtgtacatgttcacgccagagctggtcctc
gtgggtggtggaatttcaggagcggcgtcccattttctgccttctgttcgtaaggaagtt
gaacgacgggtgcaggccgtgagtcgtcaaggtctgcagattgaagcctgtgccctagga
aacggtgcaggccgtcttggggctgcccgactggccatcgaacgcttgacgtaa

DBGET integrated database retrieval system