KEGG   Synechococcus sp. CC9311: sync_1967Help
Entry
sync_1967         CDS       T00390                                 

Gene name
cbbL
Definition
(GenBank) ribulose bisphosphate carboxylase, large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
syg  Synechococcus sp. CC9311
Pathway
syg00630  Glyoxylate and dicarboxylate metabolism
syg00710  Carbon fixation in photosynthetic organisms
syg01100  Metabolic pathways
syg01120  Microbial metabolism in diverse environments
syg01200  Carbon metabolism
Module
syg_M00165  Reductive pentose phosphate cycle (Calvin cycle)
syg_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
syg_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    sync_1967 (cbbL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    sync_1967 (cbbL)
Enzymes [BR:syg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     sync_1967 (cbbL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ABI45662
CyanoBase: sync_1967
CYORF: sync_1967
UniProt: Q0I8Q2
Position
complement(1750450..1751862)
Genome map
AA seq 470 aa AA seqDB search
MSKKYDAGVKEYRDTYWTPDYVPLDTDLLACFKCTGQEGVPKEEVAAAVAAESSTGTWST
VWSELLTDLDFYKGRCYRIEDVPGDKESFYAFIAYPLDLFEEGSITNVLTSLVGNVFGFK
ALRHLRLEDIRFPIAFIKCCAGPPNGIAVERDRMNKYGRPLLGCTIKPKLGLSGKNYGRV
VYECLRGGLDFTKDDENINSQPFQRWQNRFEFVAEAIKLAEQETGERKGHYLNVTANTPE
EMYERAEFAKELNQPIIMHDFITGGFTANTGLSKWCRKNGMLLHIHRAMHAVIDRHPKHG
IHFRVLAKCLRLSGGDQLHTGTVVGKLEGDRQTTLGYIDQLRESFVPEDRSRGNFFDQDW
GSMPGVFAVASGGIHVWHMPALVAIFGDDSVLQFGGGTHGHPWGSAAGAAANRVALEACV
KARNAGREIEKESRDILMEAGKHSPELAIALETWKEIKFEFDTVDKLDVQ
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaagtacgacgctggggtcaaggagtacagagacacttactggactcccgat
tacgttcccctcgacaccgacctgctggcctgcttcaagtgcaccggccaagaaggtgtt
cccaaagaagaagttgcagctgctgttgccgctgaatcttcaactggtacctggtccact
gtgtggtccgagctcctcaccgacctcgacttctacaaaggccgctgctatcgcatcgaa
gacgtccctggtgacaaggagtcgttctatgccttcatcgcttaccccctcgacctgttc
gaagagggttcaatcactaacgttctgacctcattggtcggcaacgtgtttggtttcaaa
gcactgcgtcatctccgtctggaagacattcgcttcccgattgcatttatcaagtgctgc
gctggaccgccaaacggtattgccgttgagcgtgaccgtatgaataagtacggccgccct
cttctgggttgcaccattaagccaaagcttggcttaagcggtaagaactacggccgtgtt
gtctatgaatgcctccgtggcggtctggacttcaccaaagacgacgagaacatcaattcc
cagccgttccagcgttggcagaaccgcttcgaatttgttgcagaagccatcaagctggcc
gaacaggaaacgggagagcgaaagggtcactacctcaacgtgaccgcgaacactcctgaa
gagatgtatgagcgtgctgagttcgccaaggaactcaatcagccgatcatcatgcacgac
ttcatcaccggtggctttacagctaacactggtttgtcgaagtggtgccgcaagaacggc
atgttgctgcacattcaccgtgcgatgcacgctgtgattgaccgtcatcccaagcacggt
attcacttccgcgtcctcgccaagtgcctgcgtttgtcaggtggtgaccaactccacacc
ggcaccgtggtgggcaagctggaaggtgatcgtcagaccaccctcggctatatcgaccaa
ctccgcgaatccttcgttcctgaagatcgcagccgcggcaacttcttcgatcaggactgg
ggttccatgcctggcgtcttcgccgttgcttccggcggtatccacgtgtggcatatgccc
gcactggttgccatcttcggagatgactccgttctccagttcggtggtggtacccacggt
cacccctggggttccgcagctggtgctgctgccaaccgtgtggccctcgaggcctgcgtc
aaggcacgcaacgccggtcgtgaaatcgagaaggaaagccgcgacatccttatggaagcc
ggtaagcacagccctgagctggcgatcgctctcgagacctggaaggagatcaagttcgaa
ttcgacaccgtcgacaaactcgacgttcagtga

DBGET integrated database retrieval system