KEGG   Synechococcus sp. CC9311: sync_2044Help
Entry
sync_2044         CDS       T00390                                 

Definition
(GenBank) putative pterin-4a-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
syg  Synechococcus sp. CC9311
Pathway
syg00790  Folate biosynthesis
syg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    sync_2044
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:syg04147]
    sync_2044
Enzymes [BR:syg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     sync_2044
Exosome [BR:syg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   sync_2044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: ABI45298
CyanoBase: sync_2044
CYORF: sync_2044
UniProt: Q0I8H5
Position
1819641..1819940
Genome map
AA seq 99 aa AA seqDB search
MSKQAVLLDEAARQSLYSSCPAWTIASDGLVREWRFHSFVEAFGFMTQVALLAERANHHP
EWSNVYNRVTIRLTTHDLGGLSSRDAELAQAIDSLSPTT
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagcaagctgttttgctcgatgaagcggcacgccagagcctctactcctcttgc
cctgcctggaccattgcttctgatgggttggtaagagagtggcgctttcactcttttgtt
gaagcattcggcttcatgacacaggttgcacttctcgccgaacgcgccaatcaccatccc
gagtggagcaatgtttataaccgtgtaaccattcggctcacgacccatgatctaggtgga
ctttccagccgtgatgccgaattagctcaagcgatcgactccctctcaccaacaacttaa

DBGET integrated database retrieval system