KEGG   Synechococcus sp. CC9311: sync_2250
Entry
sync_2250         CDS       T00390                                 

Gene name
psbV
Definition
(GenBank) cytochrome c-550
  KO
K02720  photosystem II cytochrome c550
Organism
syg  Synechococcus sp. CC9311
Pathway
syg00195  Photosynthesis
Brite
KEGG Orthology (KO) [BR:syg00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    sync_2250 (psbV)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syg00194]
    sync_2250 (psbV)
Photosynthesis proteins [BR:syg00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other subunits in cyanobacteria
    sync_2250 (psbV)
SSDB
Motif
Pfam: Cytochrom_C550 Cytochrome_CBB3 Cytochrom_C
Other DBs
NCBI-ProteinID: ABI45250
CyanoBase: sync_2250
CYORF: sync_2250
UniProt: Q0I7X4
Position
1977160..1977708
AA seq 182 aa
MVRCLRQSLTSFMASFFSTLRRSLNRLLIALPVLLGLMISTPAQAAQWDAETLTVPADGD
GALVTFSEQEIKTGRKVFNVSCGTCHAGGITKTNQNVGLDTETLALATPARDNVASLVDY
LQDPTSYDGEYSIADLHPSMRSRDLYPAMRDLTDEDLRLMSGYILVAPKVLGVDWGGGKI
YF
NT seq 549 nt   +upstreamnt  +downstreamnt
ttggtgcgctgtctacgtcagtctctgacatctttcatggcctcttttttctccacattg
cgtcgatcattgaatcgactgctgatcgccctgccagtgctgcttggactgatgatcagt
acccccgcccaggccgcccagtgggatgccgagaccctcacggtgccagctgacggcgat
ggcgccctggtcactttcagtgagcaggaaatcaagacagggcggaaggtgttcaacgtc
agctgcggcacctgccatgccggcggcatcaccaaaaccaaccagaatgtgggcctggat
actgaaacgcttgcgctggccactccagcccgtgacaacgttgcgtctctcgtggattac
ctccaagaccccacgtcctatgacggggaatacagcattgccgatttacatcccagcatg
cgcagccgcgacctctatcccgcaatgcgtgatctcaccgatgaagatcttcgcctgatg
tctggatacatcctggtggctcccaaagtcttgggtgtcgattggggcggcggaaaaatt
tacttctaa

DBGET integrated database retrieval system