KEGG   Synechococcus sp. CC9311: sync_2565Help
Entry
sync_2565         CDS       T00390                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
syg  Synechococcus sp. CC9311
Pathway
syg00860  Porphyrin and chlorophyll metabolism
syg01100  Metabolic pathways
syg01110  Biosynthesis of secondary metabolites
syg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:syg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    sync_2565 (hemD)
Enzymes [BR:syg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     sync_2565 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ABI46905
CyanoBase: sync_2565
CYORF: sync_2565
UniProt: Q0I718
Position
2248666..2249475
Genome map
AA seq 269 aa AA seqDB search
MSAGGSPDLQGRTIVVTRAREQLGEARKLLEQQGARVLDLPALEIGPPDEWGPLDDALAE
LDEFHWVIFSSANGVQAVDKRLRLQGSSLGQRPAGLRIGAVGRKTARLLDQLGAPADFVP
PDFVADSLIEHFPVSGWGLRLLLPRVQSGGRTLLAEAFGEAGARVVEVPAYESRCPANMP
ESTAKALASGEVDAITFSSGKTVLHTAALLEQTLGSETASRAINSIALVSIGPQTSQRCL
EQFGRVDQEANPHDLDGLTQACLQVMQTR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctggaggcagtccagatctgcaggggcgcaccatcgtcgtcacgagggctcgc
gaacaactgggagaagcccgaaaacttttggagcaacagggtgccagggtcctggacctg
ccggctttagaaatcggacctcccgatgaatggggccctctggatgatgccctggctgaa
ttggatgaattccattgggtgatcttctccagtgccaatggggtgcaagccgttgataaa
cgtctgaggctccaaggcagcagcctgggccagagacctgctgggcttcgcatcggcgct
gtgggacgcaagacggcacggctgctggatcaactgggagcccccgctgatttcgtacca
cccgacttcgtggcagacagcctgatcgaacacttccctgtttcaggttggggactaaga
ctcctgctgccacgagtgcaaagcggaggccgcacgctgcttgcggaagcctttggggaa
gctggcgccagggtcgtcgaggttcctgcctacgaatcccgctgtccagcgaacatgcca
gaaagcacggcaaaggctttggcctcaggggaggtggatgcaatcacattcagcagtggt
aagacagttcttcatacggctgcactgctggagcaaaccctgggctctgagacagcatcc
cgtgccatcaactccatcgcacttgtgtcgattgggccccaaaccagccagcgttgtctg
gaacaatttggtcgggtggaccaggaagccaaccctcacgatctcgatggtttaacccag
gcctgccttcaggtgatgcaaacccgctga

DBGET integrated database retrieval system